Goat Polyclonal Anti-ICAM1 (aa313-327) Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ICAM1 (aa313-327) Antibody: Peptide with sequence C-PNVILTKPEVSEGTE, from the internal region of the protein sequence according to NP_000192.2. |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
NCR2 mouse monoclonal antibody, clone AT1G6, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit Polyclonal antibody to interferon alpha Receptor 1 (interferon (alpha, beta and omega) receptor 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 240 of interferon alpha Receptor 1 (Uniprot ID#P17181) |
NFATC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFATC2 |
Rabbit Polyclonal Anti-NFATC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the C terminal of human NFATC1. Synthetic peptide located within the following region: LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS |
NCR1 mouse monoclonal antibody, clone B-L46, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-ZAP70 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZAP70 |
Rabbit anti-IFNGR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNGR1 |
ICAM1 mouse monoclonal antibody, clone B-H17, Azide Free
| Applications | FC, FN, IP |
| Reactivities | Human |
NCR2 mouse monoclonal antibody, clone AT1G6, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against CD247 (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD3Z antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 113-141 amino acids from the C-terminal region of human CD3Z. |
Rabbit Polyclonal DR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DR5 antibody was raised against a peptide corresponding to 20 amino acids near the carboxy terminus of human DR5 precursor. The immunogen is located within the last 50 amino acids of DR5. |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal anti-GM-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human GM-CSF protein. |
Rabbit Polyclonal NFAT4 (Ser165) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NFAT4 around the phosphorylation site of Serine 165 |
| Modifications | Phospho-specific |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
| Modifications | Phospho-specific |
BID Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BID |
Rabbit anti-IFNB1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNB1 |
Rabbit anti-IFNAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR1 |
Rabbit anti-GRB2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRB2 |
Rabbit anti-PRKCB Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCB |
Phospho-ZAP70-Y319 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y319 of human ZAP70 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR |
Rabbit Polyclonal Anti-FASL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Rabbit Polyclonal Anti-CD253 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Germany
Japan
United Kingdom
China
