lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
Applications | FC, IHC |
Reactivities | Human |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit anti-ACTN1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACTN1 |
FCGR2A Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FCGR2A |
IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
Applications | FC, IHC, IP |
Reactivities | Human |
IL10 mouse monoclonal antibody, clone B-S10, Azide Free
Applications | ELISA, FN |
Reactivities | Human |
Alpha-actinin-1 / ACTN1 mouse monoclonal antibody, clone AT1D10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Alpha-actinin-1 / ACTN1 mouse monoclonal antibody, clone AT1D10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Goat Polyclonal Anti-IL10 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human IL10 produced in E. coli. |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
Applications | FC, IHC, IP, WB |
Reactivities | Human |
alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rabbit, Rat |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
IL10 mouse monoclonal antibody, clone BN-10, FITC
Applications | FC, IHC |
Reactivities | Human |
Conjugation | FITC |
Rabbit polyclonal anti-ACTN1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1. |
Rabbit polyclonal anti-FCGR2A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FCGR2A. |
Rabbit polyclonal CD32 (Phospho-Tyr292) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD32 around the phosphorylation site of tyrosine 292 (I-T-YP-S-L). |
Modifications | Phospho-specific |
Rabbit polyclonal FCGR2C antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FCGR2C. |
IL10 mouse monoclonal antibody, clone BN-10, PE
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE |
Goat Polyclonal Antibody against CD32 / FCGR2B
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PDALEEPDDQNRI, from the C Terminus of the protein sequence according to NP_003992.3; NP_001002273.1; NP_001002274.1; NP_001002275.1;. |
Mouse monoclonal Anti-FCGR2 Clone KB61
Reactivities | Human |
Conjugation | Unconjugated |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, Azide Free
Applications | FC |
Reactivities | Human |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, Purified
Applications | FC |
Reactivities | Human |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
alpha Actinin (ACTN1) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ACTN1 |
Rabbit polyclonal anti-IL-10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with human IL-10. |
Mouse Anti-Human CD16 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Biotinylated Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
ACTN1 (aa596-609) Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Internal region (TPQEINGKWDHVRQ) |
Rabbit Polyclonal Anti-FCGR2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FCGR2C Antibody is: synthetic peptide directed towards the N-terminal region of Human FCGR2C. Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD |
Mouse Monoclonal Anti-IL-10 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL-10 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | For immunization recombinant human IL-10 (E.coli-derived) is used |
Mouse monoclonal Anti-FCGR2 Clone 2ZC115
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-FCGR3 Clone DJ130c
Reactivities | Human |
Conjugation | Unconjugated |
Mouse anti IL-10 Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) alpha-actinin mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI9C6 (formerly 9C6)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI13G9 (formerly 13G9)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI19C10 (formerly 19C10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI13D7 (formerly 13D7)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI16E7 (formerly 16E7)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |