Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
IL10 mouse monoclonal antibody, clone B-S10, Azide Free
| Applications | ELISA, FN |
| Reactivities | Human |
Goat Polyclonal Anti-IL10 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human IL10 produced in E. coli. |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IL10 mouse monoclonal antibody, clone BN-10, FITC
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | FITC |
Rabbit polyclonal anti-ACTN1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1. |
Rabbit polyclonal anti-FCGR2A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FCGR2A. |
Rabbit polyclonal CD32 (Phospho-Tyr292) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD32 around the phosphorylation site of tyrosine 292 (I-T-YP-S-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal FCGR2C antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FCGR2C. |
IL10 mouse monoclonal antibody, clone BN-10, PE
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE |
Goat Polyclonal Antibody against CD32 / FCGR2B
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDALEEPDDQNRI, from the C Terminus of the protein sequence according to NP_003992.3; NP_001002273.1; NP_001002274.1; NP_001002275.1;. |
Mouse monoclonal Anti-FCGR2 Clone KB61
| Reactivities | Human |
| Conjugation | Unconjugated |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, Azide Free
| Applications | FC |
| Reactivities | Human |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, Purified
| Applications | FC |
| Reactivities | Human |
CD16 (FCGR3A) mouse monoclonal antibody, clone B-E16, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
alpha Actinin (ACTN1) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ACTN1 |
Rabbit polyclonal anti-IL-10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The whole rabbit serum was prepared by repeated immunizations with human IL-10. |
Mouse Anti-Human CD16 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FCGR2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FCGR2C Antibody is: synthetic peptide directed towards the N-terminal region of Human FCGR2C. Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD |
Mouse Monoclonal Anti-IL-10 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL-10 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IL-10 (E.coli-derived) is used |
Mouse monoclonal Anti-FCGR2 Clone 2ZC115
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-FCGR3 Clone DJ130c
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti IL-10 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI13D7 (formerly 13D7)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- ES Cell Differentiation/IPS
Pathways
- Systemic lupus erythematosus