Antibodies

Jump to Filters
Download
IL17E (IL25) Rabbit Polyclonal Antibody
TA328240

USD 270.00

2 Weeks

Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-17E
IL17 (IL17A) Capture Mouse Monoclonal Antibody [Clone ID: OTI4C17]
TA600015

USD 379.00

In Stock

lL-17 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C17

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700015
IL4 Capture Mouse Monoclonal Antibody [Clone ID: OTI8D4]
TA600022

USD 379.00

In Stock

IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700022
G CSF (CSF3) Rabbit Polyclonal Antibody
TA328321

USD 270.00

2 Weeks

Biotinylated Anti-Human G-CSF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human G-CSF
MCP1 (CCL2) Capture Mouse Monoclonal Antibody [Clone ID: OTI5D3]
TA600025

USD 379.00

In Stock

MCP-1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5D3

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700025
IL21 Rabbit Polyclonal Antibody
TA328245

USD 270.00

In Stock

Biotinylated Anti-Human IL-21 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-21
IL10 Capture Rat Monoclonal Antibody [Clone ID: OTI9D7]
TA600017

USD 379.00

In Stock

lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700017
IL7 Rat Monoclonal Antibody [Clone ID: BVD10-40F6]
AM01286PU-N

USD 580.00

In Stock

IL7 rat monoclonal antibody, clone BVD10-40F6, Purified

Applications ELISA
Reactivities Human
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
EPO (N-term) Rabbit Polyclonal Antibody
AP51461PU-N

USD 450.00

In Stock

EPO (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin.
IL6 Capture Mouse Monoclonal Antibody [Clone ID: OTI13A5]
TA600023

USD 379.00

In Stock

IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700023
IL8 (CXCL8) Capture Mouse Monoclonal Antibody [Clone ID: SNAP8]
TA600024

USD 379.00

In Stock

IL-8 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone SNAP8

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700024
EGFR Mouse Monoclonal Antibody [Clone ID: UMAB233]
UM800125

USD 468.00

In Stock

EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EGFR Mouse Monoclonal Antibody [Clone ID: UMAB233]
UM800125CF

USD 528.00

In Stock

Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CD130 (IL6ST) Mouse Monoclonal Antibody [Clone ID: B-P4]
AM31176AF-N

USD 270.00

2 Weeks

CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free

Applications FC, FN, IHC, IP, WB
Reactivities Human
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 424.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
Interferon beta (IFNB1) Rabbit Polyclonal Antibody
TA306437

USD 430.00

2 Weeks

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.
EGFR Rabbit Polyclonal Antibody
TA312545

USD 345.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
Interferon gamma (IFNG) Rabbit Polyclonal Antibody
TA349348

USD 380.00

In Stock

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A
Inhibin beta C chain (INHBC) Rabbit Polyclonal Antibody
TA349356

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-INHBC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human INHBC
TNF alpha (TNF) Capture Mouse Monoclonal Antibody [Clone ID: Mab1]
TA600026

USD 379.00

In Stock

TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700026
IL21 Rabbit Polyclonal Antibody
AP01130PU-N

USD 340.00

2 Weeks

IL21 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure (> 98%) E.coli derived recombinant Human IL-21
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067P1

USD 260.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
IL1 beta (IL1B) Mouse Monoclonal Antibody [Clone ID: CRM56]
TA320366

USD 170.00

2 Weeks

Mouse Anti-Human IL-1 beta Purified (50 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated
EDA Rabbit Polyclonal Antibody
TA349124

USD 484.00

5 Days

Rabbit Polyclonal Anti-EDA1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EDA1 antibody was raised against an 19 amino acid peptide near the center of human EDA1.
GRO gamma (CXCL3) Rabbit Polyclonal Antibody
TA349326

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-CXCL3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL3
CXCL14 Rabbit Polyclonal Antibody
TA349327

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL14
TNFRSF1A Rabbit Polyclonal Antibody
TA327070

USD 275.00

3 Weeks

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1
Osteoprotegerin (TNFRSF11B) Rabbit Polyclonal Antibody
TA327269

USD 275.00

In Stock

TNFRSF11B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFRSF11B
AMH Rabbit Polyclonal Antibody
TA336233

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-AMH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
IL20 Rabbit Polyclonal Antibody
TA349271

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDK2
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA349355

USD 380.00

In Stock

Rabbit Polyclonal Anti-INHBA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human INHBA
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067P2

USD 355.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
IL12A Rabbit Polyclonal Antibody
TA349020

USD 484.00

5 Days

Rabbit Polyclonal Anti-IL-12A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A.
CD40L (CD40LG) Capture Mouse Monoclonal Antibody [Clone ID: MK13A4]
TA600027

USD 379.00

In Stock

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 370.00

2 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N

USD 370.00

2 Weeks

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA308909

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A
MCP2 (CCL8) Mouse Monoclonal Antibody
TA316598

USD 425.00

In Stock

MCP-2 / CCL8 Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
IL12A Rabbit Polyclonal Antibody
TA347881

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Interleukin 12A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A
VEGFA
AB0063-200

USD 300.00

In Stock

Goat Polyclonal Anti-VEGFA Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli.
IP10 (CXCL10) Mouse Monoclonal Antibody
AM20277PU-N

USD 230.00

2 Weeks

IP10 (CXCL10) mouse monoclonal antibody, Azide Free

Applications ELISA, WB
Reactivities Human
Fas Ligand (FASLG) Mouse Monoclonal Antibody [Clone ID: B-R17]
AM31198AF-N

USD 270.00

2 Weeks

Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Azide Free

Applications FC, FN
Reactivities Human
IL6 Mouse Monoclonal Antibody [Clone ID: B-E8]
AM31351AF-N

USD 470.00

2 Weeks

IL6 mouse monoclonal antibody, clone B-E8, Azide Free

Applications ELISA, FC, FN
Reactivities Human
IL1 beta (IL1B) Rabbit Polyclonal Antibody
AP20628PU-N

USD 370.00

2 Weeks

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta
IL10 (Center) Rabbit Polyclonal Antibody
AP52181PU-N

USD 450.00

2 Weeks

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.