Germany
Japan
United Kingdom
China
Rabbit Polyclonal VHL Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VHL |
Antibodies
View as table DownloadRabbit Polyclonal Anti-ETS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal HIF-1 beta Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal HMGN phospho S20/S24 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-28 of human HMGN protein (see below). |
Rabbit polyclonal ARNT Antibody (Center V528)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARNT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 513-544 amino acids from the Central region of human ARNT. |
Rabbit polyclonal ARNT2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARNT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 249-278 amino acids from the Central region of human ARNT2. |
Rabbit polyclonal JUN Antibody (Center T93)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-98 amino acids from the Central region of human JUN. |
Rabbit Polyclonal anti-HIF1A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the N terminal of human HIF1A. Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS |
Rabbit Polyclonal anti-TCEB2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEB2 antibody: synthetic peptide directed towards the middle region of human TCEB2. Synthetic peptide located within the following region: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ |
Rabbit Polyclonal Anti-EPAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD |
Rabbit Polyclonal Anti-HIF1A Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
Rabbit polyclonal anti-ARNT2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARNT2. |
Rabbit polyclonal TGF beta 1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TGF beta 1 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of the mature growth factor (112 amino acids in length). |
Anti-ETS1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 209 amino acids of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
Anti-ARNT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 260 amino acids of human aryl hydrocarbon receptor nuclear translocator |
Rabbit Polyclonal c-Jun Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human c-Jun. |
Rabbit Polyclonal c-Jun (Ser63) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human c-Jun around the phosphorylation site of Sersine 63. |
| Modifications | Phospho-specific |
Goat Anti-ARNT (aa558-570) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SEIYHNINADQSK, from the internal region of the protein sequence according to NP_001659.1; NP_848514.1; NP_001184254.1. |
Goat Anti-ARNT (aa69-82) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CNDKERFARSDDEQS, from the internal region (near N Terminus) of the protein sequence according to NP_001659.1;. |
Rabbit Polyclonal anti-ETS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG |
Rabbit Polyclonal Anti-TCEB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the middle region of human TCEB1. Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE |
Rabbit Polyclonal Anti-TCEB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the N terminal of human TCEB1. Synthetic peptide located within the following region: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY |
Rabbit Polyclonal HIF-1 alpha [Exon 9] Antibody (exon 9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 350-400). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 10] Antibody (exon 10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 400-450). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 12] Antibody (exon 12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 550-600). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 13] Antibody (exon 13)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 700-750). [Swiss-Prot# Q16665] |
Mouse Monoclonal CrkII Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal c-JUN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Phospho C-Jun (Thr91, Thr93) Clone C-J 4C4/1
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-HIF2A Clone Hif2a 237
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-HIF2A Clone EP190b
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti TGF beta Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human TGF-beta protein. |
Rabbit anti c-Jun Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human c-Jun protein. This sequence is identical within human, rat, mouse, bovine and dog. |
Rabbit anti c-Jun(pS63) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope –LTSPD- at a phosphorylation site at serine 63 of human c-Jun protein. This sequence is identical within human, rat, mouse, bovine and dog. |
Rabbit anti TGF beta 1 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A Recombinant protein encoding human TGF beta 1 aa 177-391 expressed in E.Coli. |
Rabbit anti c-Jun (pT239) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | synthetic peptide corresponding to the epitope –GETPP-at a phosphorylation site Thr 239 of human c-Jun protein. This sequence is identical within human, rat, mouse, bovine and dog. |
Rabbit anti HIF, alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A twenty-one amino acids synthetic peptide corresponding to the internal sequence of HIF alpha protein. This sequence is identical to human, rat and mouse origins. |
JUN Capture mouse monoclonal antibody, Luminex validated, clone OTI2E11
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700108 |
Carrier-free (BSA/glycerol-free) C-Jun mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Human
Families
- Transcription Factors
Pathways
- Renal cell carcinoma