Germany
Japan
United Kingdom
China
Antibodies
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Active filters
Reactivities
- Rat
Isotypes
- IgG
Filter by
Target Symbol
- AKT1 (61)
- EGFR (42)
- MAPT (39)
- JUN (33)
- TP53 (31)
- CTNNB1 (30)
- IRS1 (30)
- STAT3 (30)
- SMAD3 (29)
- CREB1 (28)
- RELA (28)
- MAP2K1 (26)
- MAPK1 (26)
- SMAD2 (26)
- GSK3B (25)
- MAPK14 (25)
- H3-4 (24)
- NFKBIA (24)
- CASP3 (23)
- HISTONE H3 (23)
- IGF1R (23)
- PRKAA1 (23)
- STAT1 (23)
- ATF2 (22)
- FOXO1 (22)
- PTK2 (22)
- RAF1 (22)
- RPS6KB1 (22)
- VIM (22)
- YAP1 (22)
- CDC25A (21)
- EZR (21)
- PRKCA (21)
- RB1 (21)
- APP (20)
- CHUK (20)
- GRIN1 (20)
- MAPK8 (20)
- PRKCD (20)
- SRC (20)
- BAX (19)
- ERBB2 (19)
- GRIN2B (19)
- JAK2 (19)
- PTEN (19)
- SNCA (19)
- TH (19)
- BAD (18)
- GJA1 (18)
- PAK1 (18)
- PIK3R1 (18)
- BCL2 (17)
- CAMK2A (17)
- HIST1H3A (17)
- SMAD1 (17)
- SYN1 (17)
- TGFB1 (17)
- CCNB1 (16)
- FOS (16)
- GAPDH (16)
- GSK3A (16)
- HDAC1 (16)
- HDAC2 (16)
- MAP3K7 (16)
- MET (16)
- MYC (16)
- NR3C1 (16)
- PPP1R1B (16)
- PTPN11 (16)
- RUNX1 (16)
- STMN1 (16)
- YWHAZ (16)
- CASP9 (15)
- CDK2 (15)
- DOK1 (15)
- EIF4EBP1 (15)
- GRIA2 (15)
- IKBKB (15)
- MAP2K4 (15)
- NOS3 (15)
- NTRK2 (15)
- PDGFRB (15)
- PLCG1 (15)
- PRKD1 (15)
- STAT5B (15)
- ACTB (14)
- BRAF (14)
- CCND1 (14)
- CHEK1 (14)
- ELK1 (14)
- ESR1 (14)
- H3C1 (14)
- HISTONE H4 (14)
- KDR (14)
- MAP1LC3B (14)
- MTOR (14)
- RPS6KA1 (14)
- STAT5A (14)
- TSC2 (14)
- VCL (14)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (6144)
- Phospho-specific (1004)
- Acetyl K5 (4)
- Phospho S83 (4)
- Phospho S376 (3)
- Phospho T286 (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- MonoMethyl K342 (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S16 (2)
- Phospho S319 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S56 (2)
- Phospho S727 (2)
- Phospho S89 (2)
- Phospho T183/T172 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K29 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho Phospho S87 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S1033 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1248 (1)
- Phospho S129 (1)
- Phospho S1387 (1)
- Phospho S139 (1)
- Phospho S15 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S166 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S176/180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S1943 (1)
- Phospho S199/S204 (1)
- Phospho S2 (1)
- Phospho S2056 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S22 (1)
- Phospho S235/236 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S323 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S345 (1)
- Phospho S358 (1)
- Phospho S36 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S396 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S40 (1)
- Phospho S420 (1)
- Phospho S425 (1)
- Phospho S445 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S612 (1)
- Phospho S616 (1)
- Phospho S62 (1)
- Phospho S63 (1)
- Phospho S637 (1)
- Phospho S641 (1)
- Phospho S645 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S675 (1)
- Phospho S70 (1)
- Phospho S71 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S795 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S890 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S9 (1)
- Phospho S916 (1)
- Phospho S957 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser551 (1)
- Phospho Ser729 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T180/Y182 + T183/Y1845 (1)
- Phospho T183/Y185 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T199 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T204 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T232 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T261 (1)
- Phospho T288,Phospho T232,Phospho T198 (1)
- Phospho T292 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T357/S358/S360 (1)
- Phospho T359 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T56 (1)
- Phospho T567,Phospho T564,Phospho T558 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T668 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T81 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T982 (1)
- Phospho Thr421 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1021 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1070 (1)
- Phospho Y1086 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1284 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y182 (1)
- Phospho Y207 (1)
- Phospho Y221 (1)
- Phospho Y245 (1)
- Phospho Y340 (1)
- Phospho Y397 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y594 (1)
- Phospho Y653 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- Phospho Y719 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y869 (1)
- Phospho Y925 (1)
- Phospho Y980/981 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Ubiquityl K119 (1)
- citrulline R2/R8/R17 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- phospho S76 (1)
- succinylation K79 (1)
Assay Types
Families
- Druggable Genome (7734)
- Transmembrane (2830)
- Transcription Factors (1738)
- Protein Kinase (1209)
- Secreted Protein (982)
- ES Cell Differentiation/IPS (891)
- Stem cell - Pluripotency (568)
- Protease (403)
- GPCR (359)
- Adult stem cells (189)
- Stem cell relevant signaling - JAK/STAT signaling pathway (166)
- Embryonic stem cells (165)
- Phosphatase (165)
- Cancer stem cells (137)
- Nuclear Hormone Receptor (128)
- Induced pluripotent stem cells (94)
- Ion Channels: Other (92)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (76)
- Ion Channels: Glutamate Receptors (63)
- Ion Channels: Potassium (61)
- Stem cell relevant signaling - DSL/Notch pathway (55)
- Stem cell relevant signaling - Wnt Signaling pathway (46)
- Ion Channels: Cys-loop Receptors (39)
- Ion Channels: Transient receptor potential (34)
- P450 (30)
- Ion Channels: Sodium (24)
- Ion Channels: Cyclic nucleotide gated (11)
- Ion Channels: Calcium (6)
- Ion Channels: ATP Receptors (3)
Pathways
- Pathways in cancer (1318)
- Metabolic pathways (897)
- MAPK signaling pathway (851)
- Focal adhesion (751)
- Neurotrophin signaling pathway (602)
- Chemokine signaling pathway (573)
- Prostate cancer (559)
- Regulation of actin cytoskeleton (545)
- Colorectal cancer (517)
- ErbB signaling pathway (508)
- Insulin signaling pathway (496)
- Chronic myeloid leukemia (482)
- Pancreatic cancer (477)
- T cell receptor signaling pathway (452)
- Neuroactive ligand-receptor interaction (423)
- Wnt signaling pathway (414)
- Cell cycle (397)
- Cytokine-cytokine receptor interaction (392)
- Leukocyte transendothelial migration (388)
- Toll-like receptor signaling pathway (388)
- Alzheimer's disease (376)
- Small cell lung cancer (369)
- Fc gamma R-mediated phagocytosis (368)
- Calcium signaling pathway (364)
- Endocytosis (364)
- Apoptosis (362)
- Acute myeloid leukemia (360)
- Glioma (356)
- Melanoma (356)
- Adherens junction (350)
- Jak-STAT signaling pathway (350)
- Endometrial cancer (349)
- B cell receptor signaling pathway (347)
- Adipocytokine signaling pathway (346)
- Progesterone-mediated oocyte maturation (342)
- Non-small cell lung cancer (327)
- VEGF signaling pathway (326)
- GnRH signaling pathway (325)
- Renal cell carcinoma (320)
- Tight junction (320)
- Fc epsilon RI signaling pathway (314)
- Huntington's disease (313)
- Natural killer cell mediated cytotoxicity (295)
- Epithelial cell signaling in Helicobacter pylori infection (288)
- Axon guidance (285)
- Gap junction (281)
- Melanogenesis (268)
- TGF-beta signaling pathway (262)
- Amyotrophic lateral sclerosis (ALS) (257)
- Vascular smooth muscle contraction (254)
- Oocyte meiosis (252)
- Bladder cancer (233)
- p53 signaling pathway (233)
- mTOR signaling pathway (232)
- Long-term potentiation (226)
- NOD-like receptor signaling pathway (215)
- Pathogenic Escherichia coli infection (210)
- Long-term depression (205)
- RIG-I-like receptor signaling pathway (192)
- Parkinson's disease (181)
- Type II diabetes mellitus (181)
- Hypertrophic cardiomyopathy (HCM) (159)
- Cell adhesion molecules (CAMs) (156)
- Dilated cardiomyopathy (156)
- Ubiquitin mediated proteolysis (155)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (147)
- Thyroid cancer (146)
- Basal cell carcinoma (125)
- Purine metabolism (119)
- Systemic lupus erythematosus (116)
- Glycolysis / Gluconeogenesis (115)
- Viral myocarditis (112)
- Cytosolic DNA-sensing pathway (109)
- Hematopoietic cell lineage (108)
- Prion diseases (108)
- PPAR signaling pathway (104)
- Vibrio cholerae infection (100)
- Notch signaling pathway (99)
- ECM-receptor interaction (95)
- Antigen processing and presentation (94)
- Dorso-ventral axis formation (94)
- Phosphatidylinositol signaling system (94)
- Arginine and proline metabolism (84)
- Cardiac muscle contraction (76)
- Hedgehog signaling pathway (76)
- Lysosome (75)
- Oxidative phosphorylation (74)
- Ribosome (71)
- Tyrosine metabolism (70)
- Complement and coagulation cascades (69)
- Primary immunodeficiency (69)
- Spliceosome (66)
- Inositol phosphate metabolism (64)
- Alanine (60)
- aspartate and glutamate metabolism (60)
- Pyrimidine metabolism (59)
- Base excision repair (58)
- Pyruvate metabolism (58)
- Proteasome (55)
- ABC transporters (53)
- Nucleotide excision repair (53)
- Citrate cycle (TCA cycle) (52)
- Fructose and mannose metabolism (52)
- Valine (51)
- Cysteine and methionine metabolism (50)
- DNA replication (50)
- Metabolism of xenobiotics by cytochrome P450 (50)
- Regulation of autophagy (50)
- Tryptophan metabolism (50)
- Type I diabetes mellitus (50)
- Fatty acid metabolism (49)
- Maturity onset diabetes of the young (49)
- Arachidonic acid metabolism (48)
- Drug metabolism - cytochrome P450 (48)
- Glycerolipid metabolism (48)
- leucine and isoleucine degradation (47)
- Butanoate metabolism (46)
- Retinol metabolism (44)
- Glutathione metabolism (42)
- Mismatch repair (39)
- Olfactory transduction (38)
- Glycerophospholipid metabolism (36)
- RNA degradation (36)
- Homologous recombination (35)
- SNARE interactions in vesicular transport (35)
- Glycine (34)
- Starch and sucrose metabolism (34)
- serine and threonine metabolism (34)
- Phenylalanine metabolism (33)
- Renin-angiotensin system (33)
- Amino sugar and nucleotide sugar metabolism (32)
- Nitrogen metabolism (32)
- Taste transduction (32)
- Lysine degradation (30)
- Histidine metabolism (29)
- Pentose phosphate pathway (29)
- Galactose metabolism (28)
- Propanoate metabolism (28)
- beta-Alanine metabolism (26)
- Drug metabolism - other enzymes (25)
- Ether lipid metabolism (25)
- Sphingolipid metabolism (25)
- Allograft rejection (24)
- Androgen and estrogen metabolism (23)
- Graft-versus-host disease (23)
- Autoimmune thyroid disease (22)
- Non-homologous end-joining (20)
- Porphyrin and chlorophyll metabolism (20)
- Taurine and hypotaurine metabolism (20)
- Nicotinate and nicotinamide metabolism (19)
- Linoleic acid metabolism (17)
- N-Glycan biosynthesis (17)
- Biosynthesis of unsaturated fatty acids (16)
- Glyoxylate and dicarboxylate metabolism (16)
- Selenoamino acid metabolism (16)
- RNA polymerase (15)
- Basal transcription factors (14)
- Pentose and glucuronate interconversions (14)
- Asthma (13)
- Glycosaminoglycan degradation (13)
- Methane metabolism (13)
- Ascorbate and aldarate metabolism (12)
- Folate biosynthesis (12)
- One carbon pool by folate (12)
- Riboflavin metabolism (12)
- Circadian rhythm - mammal (11)
- Limonene and pinene degradation (11)
- Terpenoid backbone biosynthesis (11)
- alpha-Linolenic acid metabolism (11)
- Phenylalanine (10)
- Synthesis and degradation of ketone bodies (10)
- tyrosine and tryptophan biosynthesis (10)
- Aminoacyl-tRNA biosynthesis (9)
- O-Glycan biosynthesis (9)
- Primary bile acid biosynthesis (9)
- Fatty acid elongation in mitochondria (8)
- Fatty acid biosynthesis (7)
- C21-Steroid hormone metabolism (6)
- Caffeine metabolism (6)
- Cyanoamino acid metabolism (6)
- D-Glutamine and D-glutamate metabolism (6)
- Glycosphingolipid biosynthesis - ganglio series (6)
- Glycosphingolipid biosynthesis - lacto and neolacto series (6)
- Sulfur metabolism (6)
- Vitamin B6 metabolism (6)
- Chondroitin sulfate biosynthesis (5)
- Glycosphingolipid biosynthesis - globo series (5)
- Heparan sulfate biosynthesis (5)
- Other glycan degradation (5)
- Pantothenate and CoA biosynthesis (5)
- leucine and isoleucine biosynthesis (5)
- Keratan sulfate biosynthesis (4)
- Lysine biosynthesis (3)
- Steroid biosynthesis (3)
- Protein export (2)
- Thiamine metabolism (2)
- D-Arginine and D-ornithine metabolism (1)
- Lipoic acid metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)