Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PDE3B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Antibodies
Download
Rabbit polyclonal POLR2A (Ab-1619) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
Rabbit anti-PDE4D Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDE4D |
Rabbit anti-POLR2C Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human POLR2C |
Rabbit Polyclonal Anti-ADK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADK |
ADK (22-362) mouse monoclonal antibody, clone AT4F8, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
ADK (22-362) mouse monoclonal antibody, clone AT4F8, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
USD 480.00
2 Weeks
Natriuretic Peptide Receptor B (NPR2) (131-231) mouse monoclonal antibody, clone 2A6, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Goat Polyclonal Antibody against PDE5A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LINGESGQAKRN, from the C Terminus of the protein sequence according to NP_001074; NP_237223; NP_246273; (NP_236914). |
Rabbit polyclonal DNA Polymerase a antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human DNA Polymerase a. |
Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PDE7B antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human PDE7B. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Gorilla, Mouse, Rat, Elephant, Horse, Rabbit (88%); Opossum (82%). |
Rabbit polyclonal APRT Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APRT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-40 amino acids from the N-terminal region of human APRT. |
Rabbit polyclonal ITPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-51 amino acids from the N-terminal region of human ITPA. |
FHIT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FHIT |
POLR2I Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human POLR2I |
Rabbit anti-APRT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human APRT |
Rabbit anti-ATIC Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATIC |
Rabbit anti-HPRT1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HPRT1 |
Rabbit anti-PNP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PNP |
Rabbit Polyclonal Anti-PNPT1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED |
Rabbit Polyclonal Anti-NT5C1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C1B antibody: synthetic peptide directed towards the N terminal of human NT5C1B. Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT |
Rabbit Polyclonal Anti-APRT Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APRT antibody: synthetic peptide directed towards the N terminal of human APRT. Synthetic peptide located within the following region: ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK |
Rabbit Polyclonal Anti-POLE3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLE3 antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC |
Rabbit Polyclonal Anti-PKM2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the N terminal of human PKM2. Synthetic peptide located within the following region: MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT |
Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK |
Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: SSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH |
Rabbit Polyclonal Anti-POLR2C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Polr2c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Polr2c. Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR |
Rabbit Polyclonal Anti-NT5M Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the middle region of human NT5M. Synthetic peptide located within the following region: KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV |
Rabbit Polyclonal Anti-NT5M Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the N terminal of human NT5M. Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL |
Rabbit Polyclonal Anti-ALLC Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALLC antibody: synthetic peptide directed towards the N terminal of human ALLC. Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE |
Rabbit Polyclonal Anti-PDE4D Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE4D antibody is: synthetic peptide directed towards the C-terminal region of Human PDE4D. Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ |
Rabbit Polyclonal Anti-PDE4D Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pde4d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ |
Rabbit Polyclonal Anti-POLE4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the N terminal of human PRPS2. Synthetic peptide located within the following region: PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the N terminal of human PRPS2. Synthetic peptide located within the following region: MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV |
Rabbit Polyclonal Anti-GMPR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GMPR2 antibody: synthetic peptide directed towards the C terminal of human GMPR2. Synthetic peptide located within the following region: GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV |
Rabbit Polyclonal Anti-ADSSL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADSSL1 antibody: synthetic peptide directed towards the middle region of human ADSSL1. Synthetic peptide located within the following region: VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS |
Active filters
Pathways
- Purine metabolism
Filter by
Target Symbol
- NME1 (177)
- PDE4A (56)
- RRM1 (56)
- NME4 (55)
- PPAT (51)
- AK4 (49)
- AK5 (47)
- PDE2A (47)
- PKLR (44)
- AK1 (35)
- PDE4B (35)
- POLR2H (32)
- PAPSS2 (31)
- ENTPD1 (29)
- FHIT (28)
- DCK (26)
- HPRT1 (25)
- POLR2A (25)
- PAICS (23)
- ATIC (22)
- PDE6G (21)
- PDE10A (20)
- PDE1B (20)
- POLR2J2 (20)
- NUDT9 (19)
- PDE1A (18)
- PKM (18)
- POLR2E (18)
- POLA2 (16)
- POLR3GL (14)
- RRM2 (14)
- GUK1 (13)
- POLR2J (13)
- XDH (13)
- NT5E (12)
- POLR3H (12)
- IMPDH2 (11)
- ZNRD1 (10)
- NME2 (9)
- PDE4D (9)
- CANT1 (8)
- ENPP3 (8)
- PDE3B (8)
- ADSL (7)
- GMPR (7)
- NPR1 (7)
- POLR3C (7)
- ADA (6)
- PRPS1L1 (6)
- PRPS2 (6)
- ADK (5)
- ENTPD2 (5)
- NPR2 (5)
- PDE7B (5)
- PDE9A (5)
- PNPT1 (5)
- POLR2F (5)
- POLR2G (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- AMPD2 (4)
- APRT (4)
- ENTPD3 (4)
- GMPS (4)
- GUCY1B1 (4)
- NT5C1A (4)
- PDE11A (4)
- PDE3A (4)
- POLD1 (4)
- POLE3 (4)
- POLR2B (4)
- POLR2I (4)
- POLR3A (4)
- POLR3F (4)
- PRPS1 (4)
- ADCY2 (3)
- ADCY6 (3)
- AK2 (3)
- AMPD1 (3)
- ENTPD5 (3)
- GDA (3)
- IMPDH1 (3)
- PDE1C (3)
- PDE4C (3)
- PDE5A (3)
- PDE7A (3)
- PDE8A (3)
- PDE8B (3)
- POLA1 (3)
- POLD3 (3)
- POLR1B (3)
- POLR2C (3)
- PRIM1 (3)
- PRUNE1 (3)
- RRM2B (3)
- ADCY3 (2)
- ADCY8 (2)
- ALLC (2)
- ENPP1 (2)
Reactivities
- Human (1401)
- Rat (1071)
- Mouse (1044)
- Monkey (95)
- Dog (74)
- Bovine (25)
- Chicken (8)
- Pig (8)
- Gibbon (6)
- Horse (6)
- Gorilla (5)
- X. tropicalis (5)
- Xenopus (5)
- Orang-Utan (4)
- Rabbit (4)
- Rhesus Monkey (4)
- Cow (3)
- Zebrafish (3)
- Bat (2)
- Drosophila (2)
- Hamster (2)
- Primate (2)
- Yeast (2)
- Canine (1)
- Chimpanzee (1)
- Frog (1)
- Fruit fly (1)
- Saccharomyces cerevisiae (1)
- Sheep (1)