Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Rat
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- MAP2K1 (224)
- JUN (176)
- MAP2K3 (155)
- EGFR (139)
- GADD45G (133)
- AKT1 (109)
- MAPK13 (96)
- BRAF (90)
- MAPK1 (69)
- MEF2C (61)
- FGFR2 (59)
- FOS (59)
- MAPK7 (57)
- KRAS (56)
- MAPT (56)
- PDGFRA (55)
- MAPKAPK5 (51)
- PPP5C (51)
- HSPA1A (45)
- PPM1B (45)
- HRAS (44)
- RASGRP3 (40)
- RPS6KA2 (40)
- AKT2 (38)
- MAPK8 (37)
- PDGFRB (36)
- CASP3 (35)
- MAP2K4 (34)
- FGFR1 (33)
- MAPK14 (32)
- MYC (32)
- DUSP5 (30)
- MAP2K2 (30)
- CHP1 (27)
- DDIT3 (27)
- MAPK9 (27)
- HSPA1L (26)
- IKBKG (23)
- MAPK8IP1 (23)
- DUSP1 (22)
- DUSP10 (22)
- NTF3 (22)
- RELA (22)
- ARRB1 (21)
- PRKCA (21)
- MAP3K8 (20)
- RASA1 (20)
- ATF2 (19)
- FGF2 (19)
- MAPK10 (19)
- TP53 (19)
- ATF4 (17)
- PTPN7 (17)
- AKT3 (16)
- MAP3K7 (16)
- NTRK2 (16)
- RAF1 (16)
- TGFB1 (16)
- HSPA8 (15)
- MAPK3 (15)
- NFKB1 (14)
- STMN1 (14)
- TGFBR2 (14)
- CHUK (13)
- FGFR3 (13)
- IKBKB (13)
- PAK1 (13)
- DUSP4 (12)
- GADD45A (12)
- MAP3K13 (12)
- NRAS (12)
- PLA2G6 (12)
- FGF13 (11)
- NTF4 (11)
- MAP2K6 (10)
- NTRK1 (10)
- STK3 (10)
- ELK1 (9)
- JUND (9)
- FGF1 (8)
- PPP3CA (8)
- PPP3CB (8)
- PRKCB (8)
- RPS6KA1 (8)
- NFKB2 (7)
- PAK2 (7)
- RRAS (7)
- TGFB2 (7)
- TGFBR1 (7)
- BDNF (6)
- MAPK11 (6)
- MAPK12 (6)
- DUSP3 (5)
- FGF4 (5)
- FLNA (5)
- GRB2 (5)
- MAP3K5 (5)
- MAPKAPK2 (5)
- MRAS (5)
- PDGFB (5)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2891)
- Protein Kinase (1770)
- Transcription Factors (784)
- ES Cell Differentiation/IPS (740)
- Transmembrane (446)
- Secreted Protein (344)
- Phosphatase (185)
- Stem cell relevant signaling - JAK/STAT signaling pathway (171)
- Adult stem cells (156)
- Cancer stem cells (139)
- Stem cell - Pluripotency (137)
- Embryonic stem cells (49)
- Induced pluripotent stem cells (46)
- Stem cell relevant signaling - Wnt Signaling pathway (37)
- Protease (35)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (32)
- Ion Channels: Other (13)
- Ion Channels: Calcium (10)
- Nuclear Hormone Receptor (4)