Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ |
Rabbit Polyclonal Anti-Claudin 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 2 Antibody: A synthesized peptide derived from human Claudin 2 |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0) |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal CLDN1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CLDN1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CLDN1. The immunogen is located within the last 50 amino acids of CLDN1. |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
CLDN3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CLDN3 |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit anti-CTNNA1 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNNA1 |
Rabbit Polyclonal Anti-PPP2R2C Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp2r2c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Anti-PRKCQ (Phospho-Ser676) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 676 (R-L-S(p)-F-A) derived from Human PKC?. |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Pathways
- Tight junction
Filter by
Target Symbol
- CTNNB1 (144)
- AKT1 (112)
- PRKCE (62)
- KRAS (56)
- HRAS (44)
- AKT2 (39)
- SHC1 (29)
- ACTB (27)
- MYL7 (26)
- CLDN6 (23)
- PRKCA (22)
- SRC (18)
- AKT3 (16)
- PPP2R1B (16)
- CLDN3 (15)
- MPP5 (15)
- PRKCD (15)
- PTEN (13)
- CLDN5 (12)
- NRAS (12)
- VAPA (12)
- ACTN1 (10)
- CTTN (10)
- EXOC4 (10)
- CTNNA1 (9)
- SPTAN1 (9)
- CLDN1 (8)
- CLDN7 (8)
- PRKCB (8)
- MYL9 (7)
- PRKCQ (7)
- RHOA (7)
- CLDN4 (6)
- GNAI1 (6)
- PRKCZ (6)
- RRAS (6)
- ACTG1 (5)
- CLDN10 (5)
- CLDN11 (5)
- MRAS (5)
- PARD6A (5)
- PPP2R1A (5)
- CDC42 (4)
- CSNK2A1 (4)
- CSNK2B (4)
- HCLS1 (4)
- MYH1 (4)
- PRKCG (4)
- ACTN2 (3)
- ACTN3 (3)
- ACTN4 (3)
- CDK4 (3)
- CLDN14 (3)
- PPP2CA (3)
- PPP2R2A (3)
- RRAS2 (3)
- TJP1 (3)
- CASK (2)
- CLDN16 (2)
- CLDN19 (2)
- EPB41 (2)
- EPB41L3 (2)
- F11R (2)
- GNAI3 (2)
- MAGI2 (2)
- MAP3K20 (2)
- MYH11 (2)
- MYH7 (2)
- MYL2 (2)
- PARD3 (2)
- PPP2CB (2)
- PRKCH (2)
- AMOTL1 (1)
- CLDN2 (1)
- CSNK2A2 (1)
- CTNNA3 (1)
- GNAI2 (1)
- JAM2 (1)
- JAM3 (1)
- LLGL1 (1)
- LLGL2 (1)
- MLLT4 (1)
- MYH14 (1)
- MYH6 (1)
- MYL12B (1)
- PARD6B (1)
- PPP2R2C (1)
- PPP2R2D (1)
- TJP2 (1)
- YBX3 (1)
- YES1 (1)