Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Goat Anti-CBARA1 (aa113-126) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EYENRIRAYSTPDK, from the internal region of the protein sequence according to NP_006068.2; NP_001182447.1. |
Goat Polyclonal Antibody against HPS6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence LRTELRDYRGLEC, from the internal region of the protein sequence according to NP_079023. |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal Anti-OAT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
GNAT3 / Gustducin Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GNAT3 / Gustducin antibody was raised against synthetic peptide C-KNQFLDLNLKKEDKE from an internal region of human GNAT3 (NP_001095856.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Bat, Lizard (93%); Platypus (87%); Turkey, Chicken (80%). |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
FSP1 / S100A4 Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | S100A4 / FSP1 antibody was raised against synthetic peptide CNEFFEGFPDKQP from the C-terminus of human S100A4 / FSP1 (NP_002952.1; NP_062427.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Elephant, Bat (92%); Mouse, Rat (85%). |
Goat Polyclonal Anti-PCNA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Goat Polyclonal Anti-IDH3B (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B (aa33-46) Antibody: Peptide with sequence C-HAASRSQAEDVRVE, from the internal region (near N Terminus) of the protein sequence according to NP_008830.2; NP_777280.1. |
Goat Polyclonal Anti-IDH3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3A Antibody: Peptide with sequence DFTEEICRRVKDLD, from the C Terminus of the protein sequence according to NP_005521.1. |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Goat Polyclonal Antibody against PRPF31
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KELGNSLDKCKNNEN, from the internal region of the protein sequence according to NP_056444.2. |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Goat Anti-Phospholamban / PLN Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KVQYLTRSAIRR-C, from the N Terminus of the protein sequence according to NP_002658.1. |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Goat Polyclonal Antibody against KLF3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence LMFDPVPVKQEAMD-C, from the N Terminus of the protein sequence according to NP_057615. |
Goat Anti-ERN1 / IRE1a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PNAHGKIKAMISD, from the internal region of the protein sequence according to NP_001424.3. |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TGFBI Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TGFBI antibody was raised against synthetic peptide C-QLYTDRTEKLRPE from an internal region of human TGFBI (NP_000349.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Platypus (92%). |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Active filters
Reactivities
- Pig
Filter by
Category
Target Symbol
- GPR4 (5)
- HSPA1A (5)
- MEF2C (5)
- CD3E (4)
- ACTA1 (3)
- CFL2 (3)
- DCN (3)
- DUSP6 (3)
- FTCD (3)
- HCRTR1 (3)
- HSP90B1 (3)
- MYC (3)
- NRAS (3)
- PON2 (3)
- SMAD3 (3)
- SOD2 (3)
- STK26 (3)
- ACO2 (2)
- ADAP1 (2)
- ADRA1B (2)
- AIF1 (2)
- AIRE (2)
- ALB (2)
- ANXA1 (2)
- APEX1 (2)
- APP (2)
- CANX (2)
- CAPZB (2)
- CD79A (2)
- CKB (2)
- CLDN14 (2)
- CNTN1 (2)
- CTSK (2)
- FOXP2 (2)
- FYN (2)
- GAD2 (2)
- GAPDH (2)
- GLG1 (2)
- GNAS (2)
- GOT2 (2)
- GPX2 (2)
- GRPR (2)
- H2AFZ (2)
- HCAR1 (2)
- HMGA1 (2)
- HNF1A (2)
- HOXA5 (2)
- HPRT1 (2)
- HPS3 (2)
- HPS6 (2)
- HSPD1 (2)
- INSR (2)
- IVL (2)
- JUN (2)
- JUP (2)
- KCNJ6 (2)
- KCNMA1 (2)
- KIT (2)
- KRT18 (2)
- MAOB (2)
- MDH1 (2)
- NOD1 (2)
- NQO1 (2)
- NR5A1 (2)
- OGT (2)
- PCBP2 (2)
- PCK1 (2)
- PLN (2)
- PRKAA2 (2)
- PSMB8 (2)
- PTBP1 (2)
- PTGES (2)
- RAC1 (2)
- RAE1 (2)
- RXRB (2)
- SEC61A1 (2)
- SLC39A14 (2)
- SMAD4 (2)
- SNAP25 (2)
- SOCS5 (2)
- SYK (2)
- SYNGAP1 (2)
- SYNTAXIN (2)
- TBP (2)
- TM9SF3 (2)
- TP53 (2)
- TPT1 (2)
- UCHL1 (2)
- WNT4 (2)
- WNT9B (2)
- AAPK1 (1)
- ABCC5 (1)
- ABHD14B (1)
- ACAD8 (1)
- ACAP2 (1)
- ACSL4 (1)
- ACTC1 (1)
- ACTL6B (1)
- ACTN1 (1)
- ACTR1A (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
- Phospho-specific (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (509)
- Transmembrane (196)
- Transcription Factors (122)
- Secreted Protein (67)
- ES Cell Differentiation/IPS (50)
- GPCR (45)
- Stem cell - Pluripotency (43)
- Protein Kinase (35)
- Protease (30)
- Nuclear Hormone Receptor (13)
- Phosphatase (13)
- Stem cell relevant signaling - JAK/STAT signaling pathway (12)
- Embryonic stem cells (11)
- Adult stem cells (10)
- Cancer stem cells (9)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (7)
- Stem cell relevant signaling - Wnt Signaling pathway (7)
- Ion Channels: Other (6)
- Ion Channels: Potassium (6)
- Ion Channels: Transient receptor potential (6)
- Induced pluripotent stem cells (5)
- Ion Channels: Cys-loop Receptors (1)
- Ion Channels: Sodium (1)
Pathways
- Metabolic pathways (99)
- Pathways in cancer (61)
- MAPK signaling pathway (40)
- Wnt signaling pathway (36)
- Neuroactive ligand-receptor interaction (32)
- Regulation of actin cytoskeleton (23)
- Huntington's disease (22)
- Prostate cancer (22)
- Focal adhesion (21)
- Melanogenesis (21)
- Calcium signaling pathway (20)
- Colorectal cancer (20)
- Neurotrophin signaling pathway (20)
- T cell receptor signaling pathway (20)
- Chronic myeloid leukemia (19)
- Insulin signaling pathway (19)
- Arginine and proline metabolism (18)
- Alzheimer's disease (17)
- Cell cycle (17)
- TGF-beta signaling pathway (17)
- Acute myeloid leukemia (16)
- Adipocytokine signaling pathway (16)
- B cell receptor signaling pathway (16)
- Natural killer cell mediated cytotoxicity (16)
- Pancreatic cancer (16)
- Vascular smooth muscle contraction (16)
- Adherens junction (15)
- Axon guidance (15)
- Bladder cancer (15)
- Chemokine signaling pathway (15)
- Citrate cycle (TCA cycle) (15)
- Endocytosis (15)
- ErbB signaling pathway (15)
- Fc epsilon RI signaling pathway (15)
- Fc gamma R-mediated phagocytosis (15)
- Leukocyte transendothelial migration (15)
- Tight junction (15)
- Basal cell carcinoma (14)
- Endometrial cancer (14)
- Glycolysis / Gluconeogenesis (14)
- Pathogenic Escherichia coli infection (14)
- Cell adhesion molecules (CAMs) (13)
- GnRH signaling pathway (13)
- Jak-STAT signaling pathway (13)
- Melanoma (13)
- PPAR signaling pathway (13)
- Thyroid cancer (13)
- Dilated cardiomyopathy (12)
- Gap junction (12)
- Non-small cell lung cancer (12)
- Oocyte meiosis (12)
- Renal cell carcinoma (12)
- Antigen processing and presentation (11)
- Epithelial cell signaling in Helicobacter pylori infection (11)
- Long-term depression (11)
- Parkinson's disease (11)
- Primary immunodeficiency (11)
- Progesterone-mediated oocyte maturation (11)
- Small cell lung cancer (11)
- Toll-like receptor signaling pathway (11)
- Glioma (10)
- Hedgehog signaling pathway (10)
- Hypertrophic cardiomyopathy (HCM) (10)
- Spliceosome (10)
- Alanine (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (9)
- Cytokine-cytokine receptor interaction (9)
- Prion diseases (9)
- Pyruvate metabolism (9)
- VEGF signaling pathway (9)
- aspartate and glutamate metabolism (9)
- Amyotrophic lateral sclerosis (ALS) (8)
- Arachidonic acid metabolism (8)
- Cysteine and methionine metabolism (8)
- Histidine metabolism (8)
- Long-term potentiation (8)
- Lysosome (8)
- NOD-like receptor signaling pathway (8)
- One carbon pool by folate (8)
- Oxidative phosphorylation (8)
- Phenylalanine metabolism (8)
- Purine metabolism (8)
- Systemic lupus erythematosus (8)
- Tyrosine metabolism (8)
- Ubiquitin mediated proteolysis (8)
- Viral myocarditis (8)
- mTOR signaling pathway (8)
- Apoptosis (7)
- Cardiac muscle contraction (7)
- Hematopoietic cell lineage (7)
- Maturity onset diabetes of the young (7)
- Type I diabetes mellitus (7)
- Fatty acid metabolism (6)
- Glutathione metabolism (6)
- Glycerolipid metabolism (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Proteasome (6)
- Regulation of autophagy (6)
- Ribosome (6)
- Vibrio cholerae infection (6)
- p53 signaling pathway (6)
- Butanoate metabolism (5)
- Drug metabolism - cytochrome P450 (5)
- Glycerophospholipid metabolism (5)
- Glycine (5)
- Propanoate metabolism (5)
- Tryptophan metabolism (5)
- Type II diabetes mellitus (5)
- Valine (5)
- beta-Alanine metabolism (5)
- leucine and isoleucine degradation (5)
- serine and threonine metabolism (5)
- Base excision repair (4)
- Complement and coagulation cascades (4)
- Limonene and pinene degradation (4)
- Lysine degradation (4)
- Taste transduction (4)
- Amino sugar and nucleotide sugar metabolism (3)
- Autoimmune thyroid disease (3)
- Fructose and mannose metabolism (3)
- Inositol phosphate metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Methane metabolism (3)
- Notch signaling pathway (3)
- Phenylalanine (3)
- Pyrimidine metabolism (3)
- RIG-I-like receptor signaling pathway (3)
- RNA degradation (3)
- Starch and sucrose metabolism (3)
- Taurine and hypotaurine metabolism (3)
- tyrosine and tryptophan biosynthesis (3)
- Allograft rejection (2)
- Ascorbate and aldarate metabolism (2)
- Basal transcription factors (2)
- Biosynthesis of unsaturated fatty acids (2)
- Drug metabolism - other enzymes (2)
- Galactose metabolism (2)
- Nitrogen metabolism (2)
- Nucleotide excision repair (2)
- O-Glycan biosynthesis (2)
- Phosphatidylinositol signaling system (2)
- Renin-angiotensin system (2)
- Sphingolipid metabolism (2)
- ABC transporters (1)
- Androgen and estrogen metabolism (1)
- Asthma (1)
- Circadian rhythm - mammal (1)
- Cytosolic DNA-sensing pathway (1)
- D-Arginine and D-ornithine metabolism (1)
- D-Glutamine and D-glutamate metabolism (1)
- DNA replication (1)
- Dorso-ventral axis formation (1)
- ECM-receptor interaction (1)
- Ether lipid metabolism (1)
- Fatty acid biosynthesis (1)
- Glycosaminoglycan degradation (1)
- Graft-versus-host disease (1)
- Linoleic acid metabolism (1)
- Lipoic acid metabolism (1)
- Mismatch repair (1)
- N-Glycan biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- Olfactory transduction (1)
- Other glycan degradation (1)
- Pantothenate and CoA biosynthesis (1)
- Pentose phosphate pathway (1)
- RNA polymerase (1)
- Retinol metabolism (1)
- Riboflavin metabolism (1)
- Selenoamino acid metabolism (1)
- Sulfur metabolism (1)
- alpha-Linolenic acid metabolism (1)