TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584] |
Rabbit Polyclonal IL-36G Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-36G antibody was raised against a 13 amino acid peptide near the carboxy terminus of human IL-36G. |
Rabbit anti-BDNF Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BDNF |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta |
IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
Rabbit Monoclonal antibody against WNT5B
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-MASP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Periostin (POSTN) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 687-716 amino acids from the C-terminal region of human Periostin. |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT |
Periostin (POSTN) rabbit polyclonal antibody, Azide Free
Applications | ELISA, IHC, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Immunogen | Recombinant Human OSF-2 Source of Antigen: E. coli. |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal IL8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Rat |
Immunogen | This CALR Antibody is generated from rabbits immunized with a recombinant protein of human CALR. |
Rabbit Polyclonal antibody to IL1F9 (interleukin 1 family, member 9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 105 and 169 of IL1F9 (Uniprot ID#Q9NZH8) |
Rabbit Polyclonal Anti-WNT5A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal Wnt10a Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Wnt10a antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Wnt10a. |
Rabbit polyclonal Galectin 3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Galectin 3. |
Rabbit Polyclonal Anti-WNT5B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Rat |
Immunogen | This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR. |
IL6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 26-55 amino acids from the Central region of Human Interleukin-6 |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit Polyclonal antibody to IL1ra antagonist (interleukin 1 receptor antagonist)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 177 of IL1ra antagonist (Uniprot ID#P18510) |
WNT2B Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit polyclonal anti-Wnt-6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit polyclonal IL1RN Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL1RN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 100-129 amino acids from the Central region of human IL1RN. |
Rabbit Polyclonal IL-36A Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-36A antibody was raised against an 11 amino acid peptide near the carboxy terminus of human IL-36A. |
Rabbit Polyclonal IL-36B Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-36B antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-36B. |
Rabbit anti-IL1B Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL1B |
Rabbit Polyclonal Anti-WNT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL |
Rabbit Polyclonal Anti-WNT5B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B. Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT |
Rabbit Polyclonal Anti-WNT7B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal CD130 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal IL1RN/IL1RA Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Rabbit Polyclonal IL1RN/IL1RA Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | ACE2 antibody was raised against synthetic peptide |
USD 440.00
2 Weeks
Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | ACE2 antibody was raised against synthetic peptide |