Germany
Japan
United Kingdom
China
Research Areas
View as table Download
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT |
Periostin (POSTN) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Recombinant Human OSF-2 Source of Antigen: E. coli. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Rat |
| Immunogen | This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR. |
IL4 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit Polyclonal antibody to IL1ra antagonist (interleukin 1 receptor antagonist)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 177 of IL1ra antagonist (Uniprot ID#P18510) |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit polyclonal IL1RN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1RN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 100-129 amino acids from the Central region of human IL1RN. |
Rabbit anti-IL1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1B |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL |
Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B. Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
USD 440.00
2 Weeks
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Filter by
Target Symbol
- WNT1 (9)
- WNT5B (8)
- WNT2B (7)
- IL6ST (6)
- TNF (6)
- WNT10A (6)
- WNT3A (6)
- WNT4 (6)
- WNT6 (6)
- WNT9A (6)
- CD8A (5)
- IL1RN (5)
- WNT16 (5)
- WNT2 (5)
- IL1B (4)
- IL6 (4)
- CRP (3)
- IL10 (3)
- IL1RL1 (3)
- IL4 (3)
- WNT11 (3)
- WNT5A (3)
- ACE2 (2)
- CALR (2)
- CXCL8 (2)
- ENTPD6 (2)
- FRZB (2)
- IL36G (2)
- IL36RN (2)
- LGALS3 (2)
- POSTN (2)
- TNFRSF1B (2)
- WNT7A (2)
- BDNF (1)
- CCL3 (1)
- CSF3 (1)
- FCER2 (1)
- FCGR3A (1)
- IL12B (1)
- IL18 (1)
- IL1F10 (1)
- IL1RAP (1)
- IL2 (1)
- IL33 (1)
- IL36A (1)
- IL36B (1)
- IL37 (1)
- MASP2 (1)
- WNT7B (1)
Reactivities
Clonalities
Conjugates
Pathways
- Pathways in cancer (79)
- Basal cell carcinoma (73)
- Hedgehog signaling pathway (73)
- Melanogenesis (73)
- Wnt signaling pathway (73)
- Cytokine-cytokine receptor interaction (36)
- Hematopoietic cell lineage (24)
- Jak-STAT signaling pathway (19)
- T cell receptor signaling pathway (18)
- Toll-like receptor signaling pathway (18)
- NOD-like receptor signaling pathway (17)
- Graft-versus-host disease (15)
- Allograft rejection (14)
- Asthma (12)
- Type I diabetes mellitus (12)
- Apoptosis (11)
- MAPK signaling pathway (11)
- Alzheimer's disease (10)
- Cytosolic DNA-sensing pathway (10)
- Hypertrophic cardiomyopathy (HCM) (10)
- Systemic lupus erythematosus (10)
- Fc epsilon RI signaling pathway (9)
- RIG-I-like receptor signaling pathway (9)
- Adipocytokine signaling pathway (8)
- Amyotrophic lateral sclerosis (ALS) (8)
- Prion diseases (8)
- Antigen processing and presentation (7)
- Autoimmune thyroid disease (7)
- Natural killer cell mediated cytotoxicity (7)
- Dilated cardiomyopathy (6)
- TGF-beta signaling pathway (6)
- Type II diabetes mellitus (6)
- Cell adhesion molecules (CAMs) (5)
- Primary immunodeficiency (5)
- Chemokine signaling pathway (3)
- Bladder cancer (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Renin-angiotensin system (2)
- Complement and coagulation cascades (1)
- Fc gamma R-mediated phagocytosis (1)
- Huntington's disease (1)
- Neurotrophin signaling pathway (1)