Germany
Japan
United Kingdom
China
Research Areas
Download
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
USD 399.00
In Stock
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
USD 440.00
2 Weeks
IL1 Receptor I (IL1R1) (Extracell. Dom.) mouse monoclonal antibody, clone 40101, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
IL6R mouse monoclonal antibody, clone B-R6, Azide Free
| Applications | FC, FN, IHC, IP |
| Reactivities | Human |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Purified
| Applications | FC, IHC, IP |
| Reactivities | Porcine |
USD 300.00
In Stock
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
USD 515.00
In Stock
Rabbit Polyclonal Anti-FZD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Active filters
Applications
- IHC
Families
- Transmembrane
Filter by
Target Symbol
- PECAM1 (106)
- CD4 (85)
- CD99 (77)
- PTPRC (72)
- NCAM1 (57)
- CD68 (56)
- MS4A1 (55)
- PDCD1 (54)
- KIT (52)
- CR2 (47)
- TNFRSF8 (41)
- CD2 (36)
- CD8A (35)
- CD34 (33)
- FCER2 (33)
- CD14 (30)
- CD19 (29)
- CD5 (29)
- MME (29)
- CD22 (27)
- ROR2 (27)
- CD79B (25)
- WNT3 (22)
- ANPEP (21)
- CD274 (19)
- TNF (16)
- CD3E (15)
- ITGB3 (14)
- CD33 (12)
- FCGR1A (12)
- CD74 (11)
- CD79A (11)
- TLR8 (10)
- CD7 (8)
- IL12B (8)
- TLR4 (8)
- ROR1 (7)
- TLR3 (7)
- HLA-DRB5 (6)
- IL6R (6)
- ITGAX (6)
- TLR2 (6)
- TLR5 (5)
- TLR6 (5)
- WNT1 (5)
- WNT10A (5)
- CD163 (4)
- CD46 (4)
- FCGR3A (4)
- FZD2 (4)
- FZD8 (4)
- IL1R1 (4)
- IL2RA (4)
- TLR7 (4)
- CD1A (3)
- FZD4 (3)
- FZD9 (3)
- IL1RL1 (3)
- IL6ST (3)
- ITGA2B (3)
- LRP5 (3)
- LRP6 (3)
- TLR1 (3)
- WNT11 (3)
- WNT16 (3)
- WNT6 (3)
- WNT9A (3)
- ACE2 (2)
- CXCL8 (2)
- FZD1 (2)
- FZD3 (2)
- FZD5 (2)
- FZD6 (2)
- HLA-DMB (2)
- HLA-G (2)
- IL18R1 (2)
- IL1R2 (2)
- ITGAE (2)
- PTK7 (2)
- TLR9 (2)
- TNFRSF1B (2)
- WNT4 (2)
- WNT7A (2)
- BDNF (1)
- CD207 (1)
- ENTPD6 (1)
- FUT4 (1)
- FZD10 (1)
- FZD7 (1)
- HFE (1)
- HLA-B (1)
- HLA-DMA (1)
- HLA-DOA (1)
- HLA-DPB1 (1)
- HLA-F (1)
- IL1RAP (1)
- IL1RL2 (1)
- IL3RA (1)
- TLR10 (1)
- TMED1 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Pathways
- Hematopoietic cell lineage (647)
- Cell adhesion molecules (CAMs) (616)
- T cell receptor signaling pathway (277)
- Primary immunodeficiency (247)
- Leukocyte transendothelial migration (183)
- Antigen processing and presentation (146)
- Cytokine-cytokine receptor interaction (144)
- B cell receptor signaling pathway (139)
- Pathways in cancer (130)
- Melanogenesis (125)
- Toll-like receptor signaling pathway (106)
- Fc gamma R-mediated phagocytosis (88)
- Wnt signaling pathway (79)
- Basal cell carcinoma (73)
- Endocytosis (60)
- Prion diseases (57)
- Lysosome (56)
- Regulation of actin cytoskeleton (55)
- MAPK signaling pathway (53)
- Acute myeloid leukemia (52)
- Renin-angiotensin system (52)
- Complement and coagulation cascades (51)
- Hedgehog signaling pathway (49)
- Alzheimer's disease (45)
- Pathogenic Escherichia coli infection (43)
- Systemic lupus erythematosus (43)
- Allograft rejection (39)
- Type I diabetes mellitus (39)
- Dilated cardiomyopathy (33)
- Hypertrophic cardiomyopathy (HCM) (33)
- Graft-versus-host disease (31)
- Asthma (27)
- RIG-I-like receptor signaling pathway (26)
- Colorectal cancer (24)
- Natural killer cell mediated cytotoxicity (23)
- Apoptosis (22)
- Jak-STAT signaling pathway (22)
- Metabolic pathways (22)
- Glutathione metabolism (21)
- Adipocytokine signaling pathway (18)
- Amyotrophic lateral sclerosis (ALS) (18)
- NOD-like receptor signaling pathway (18)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (17)
- ECM-receptor interaction (17)
- Focal adhesion (17)
- Fc epsilon RI signaling pathway (16)
- TGF-beta signaling pathway (16)
- Type II diabetes mellitus (16)
- Autoimmune thyroid disease (15)
- Viral myocarditis (15)
- Small cell lung cancer (3)
- Bladder cancer (2)
- Chemokine signaling pathway (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Neurotrophin signaling pathway (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)