Germany
Japan
United Kingdom
China
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Products
View as table Download
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
| Applications | FC, IHC, WB |
| Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
TA336650 is a possible alternative to TA336566.
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Transferrin (TF) (N-term) mouse monoclonal antibody, clone HTF-14, Aff - Purified
| Applications | ELISA, FN, IF, WB |
| Reactivities | Human, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region of the human LC3 protein (within residues 50-120). [Swiss-Prot Q9H492] |
GAPDH mouse monoclonal antibody, clone 4G5
| Applications | ELISA, IF, WB |
| Reactivities | Bovine, Feline, Goat, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Mouse Monoclonal anti-RHO Antibody
| Applications | IF |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
USD 530.00
2 Weeks
USD 530.00
2 Weeks
MYD88 mouse monoclonal antibody, clone 603E10.06
| Applications | FC, IF |
| Reactivities | Canine, Human, Porcine |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against TIP47
| Applications | WB |
| Reactivities | Human, Primate, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the C-terminus (within residues 350-435) of the human TIP47 protein. [Swiss-Prot# O60664] |
Active filters
Reactivities
- Porcine
Applications
- IF
Filter by
Category
Target Symbol
- DCX (3)
- GAPDH (3)
- CANX (2)
- NEFH (2)
- UCHL1 (2)
- ACAN (1)
- ACTB (1)
- AQP2 (1)
- ATG5 (1)
- ATP1A1 (1)
- BECN1 (1)
- CALR (1)
- CELF1 (1)
- EGR2 (1)
- FASN (1)
- INS (1)
- KCNA2 (1)
- KDELR1 (1)
- LOX (1)
- MAP1LC3B (1)
- MKI67 (1)
- MUC1 (1)
- NEFL (1)
- NEFM (1)
- NPC1 (1)
- PLIN3 (1)
- PRDM1 (1)
- PRKCA (1)
- RBFOX3 (1)
- RHO (1)
- SIAH2 (1)
- SYCP3 (1)
- TUBB (1)
- UBB (1)
- VIM (1)
Antibody Hosts
Clonalities
Families
Pathways
- Amyotrophic lateral sclerosis (ALS) (4)
- Metabolic pathways (4)
- Alzheimer's disease (3)
- Antigen processing and presentation (3)
- Glycolysis / Gluconeogenesis (3)
- Parkinson's disease (3)
- Pathogenic Escherichia coli infection (3)
- Regulation of autophagy (3)
- Vibrio cholerae infection (3)
- Focal adhesion (2)
- Gap junction (2)
- Insulin signaling pathway (2)
- Leukocyte transendothelial migration (2)
- Regulation of actin cytoskeleton (2)
- Tight junction (2)
- Adherens junction (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Calcium signaling pathway (1)
- Cardiac muscle contraction (1)
- Dilated cardiomyopathy (1)
- ErbB signaling pathway (1)
- Fatty acid biosynthesis (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Glioma (1)
- GnRH signaling pathway (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysosome (1)
- MAPK signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Melanogenesis (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-small cell lung cancer (1)
- Oocyte meiosis (1)
- Pathways in cancer (1)
- Phosphatidylinositol signaling system (1)
- Progesterone-mediated oocyte maturation (1)
- Prostate cancer (1)
- RIG-I-like receptor signaling pathway (1)
- Type I diabetes mellitus (1)
- Type II diabetes mellitus (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)
- mTOR signaling pathway (1)