Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Adenosine Receptor A2a (ADORA2A) (full length) Mouse Monoclonal Antibody [Clone ID: 7F6-G5-A2 / 7F6]
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Rabbit, Guinea pig (85%); Bovine, Elephant, Horse, Pig (80%). |
Rabbit Polyclonal Anti-ATP2A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Active filters
Applications
- IHC
Pathways
- Calcium signaling pathway
Filter by
Category
Target Symbol
- ERBB2 (108)
- EGFR (59)
- GNAS (32)
- ERBB3 (26)
- TNNC1 (24)
- GNA14 (21)
- CHP1 (17)
- PDGFRA (17)
- PDGFRB (17)
- CD38 (13)
- ERBB4 (12)
- PHKG2 (12)
- CAMK2B (10)
- GRIN1 (10)
- PPP3CA (10)
- PRKCA (9)
- SPHK1 (9)
- ADRA1B (7)
- F2R (7)
- GRM1 (7)
- PDE1B (7)
- CAMK2A (6)
- CCKAR (6)
- GRPR (6)
- HTR2C (6)
- NOS2 (6)
- PDE1A (6)
- ADORA2A (5)
- ADRA1A (5)
- ADRB2 (5)
- HTR2B (5)
- HTR4 (5)
- NOS3 (5)
- NTSR1 (5)
- PTK2B (5)
- VDAC1 (5)
- ADORA2B (4)
- ADRB3 (4)
- CACNA1C (4)
- CAMK4 (4)
- CHRM1 (4)
- GRIN2A (4)
- GRM5 (4)
- HTR7 (4)
- P2RX2 (4)
- PLCB3 (4)
- PTGER3 (4)
- ADCY1 (3)
- AGTR1 (3)
- ATP2A1 (3)
- BDKRB2 (3)
- CHRM2 (3)
- CYSLTR2 (3)
- DRD5 (3)
- HRH1 (3)
- HTR5A (3)
- LTB4R2 (3)
- MYLK3 (3)
- P2RX1 (3)
- PLCG1 (3)
- SLC25A4 (3)
- SLC8A3 (3)
- TBXA2R (3)
- ADCY4 (2)
- ADRA1D (2)
- ATP2A3 (2)
- BDKRB1 (2)
- CACNA1H (2)
- CHRM5 (2)
- CYSLTR1 (2)
- DRD1 (2)
- EDNRB (2)
- GNA11 (2)
- GNAL (2)
- GRIN2C (2)
- GRIN2D (2)
- HTR2A (2)
- HTR6 (2)
- ITPR2 (2)
- LHCGR (2)
- NOS1 (2)
- OXTR (2)
- P2RX3 (2)
- PHKA1 (2)
- PHKA2 (2)
- PPP3CC (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- RYR1 (2)
- RYR2 (2)
- SPHK2 (2)
- TACR1 (2)
- TACR2 (2)
- TACR3 (2)
- TRPC1 (2)
- VDAC2 (2)
- ADCY3 (1)
- ADCY7 (1)
Reactivities
- Human (581)
- Mouse (444)
- Rat (434)
- Monkey (44)
- Dog (32)
- Bovine (20)
- Gorilla (17)
- Rabbit (15)
- Bat (14)
- Gibbon (12)
- Horse (12)
- Pig (11)
- Hamster (9)
- Chimpanzee (4)
- Chicken (3)
- Guinea Pig (3)
- Orang-Utan (3)
- Rhesus Monkey (3)
- Xenopus (3)
- Cow (2)
- Porcine (2)
- Canine (1)
- Feline (1)
- Fish (1)
- Macaque (1)
- Primate (1)
- Sheep (1)
- X. tropicalis (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (666)
- Transmembrane (483)
- Protein Kinase (300)
- GPCR (141)
- Secreted Protein (117)
- ES Cell Differentiation/IPS (115)
- Adult stem cells (85)
- Cancer stem cells (72)
- Stem cell relevant signaling - JAK/STAT signaling pathway (59)
- Stem cell - Pluripotency (26)
- Ion Channels: Glutamate Receptors (18)
- Phosphatase (14)
- Induced pluripotent stem cells (13)
- Ion Channels: Calcium (11)
- Ion Channels: ATP Receptors (10)
- Ion Channels: Other (8)
- Transcription Factors (5)
- Ion Channels: Sodium (4)
- Ion Channels: Transient receptor potential (2)
- Ion Channels: Cys-loop Receptors (1)