Germany
Japan
United Kingdom
China
Herpes Virus Type 8 / HHV8 Cyclin sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Human |
| Immunogen | Inclusion Bodies from E. Coli expressing His-tagged full length Human Cyclin G2 protein. |
Products
DownloadPGI1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | Phosphoglucose isomerase isolated and purified from baker’s yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction
| Applications | Assay, CT, FC, FN, IHC, IP |
| Reactivities | Mouse, Rat |
| Immunogen | Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant. |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit anti-DBI Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBI |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Thermonuclease rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Staphylococcus aureus |
| Immunogen | Nuclease isolated and purified from Staphylococcus aureus. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Collagen II (COL2A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
C Reactive Protein (CRP) goat polyclonal antibody, Serum
| Applications | ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | Capsular Reactive Protein (CRP) from Human Serum. |
Mouse IgG (Fc specific) goat polyclonal antibody, Aff - Purified
| Applications | Suitable for Immunoprecipitation, Immunodiffusion, conjugation and most immunological methods requiring lot-to-lot consistency, high titer and specificity. Recommended Dilutions: ELISA: 1/20,000-1/100,000. Western blot: 1/2,000-1/10,000. Immunohistochemistry: 1/1,000-1/5,000. |
| Reactivities | Mouse |
| Immunogen | Anti-Mouse IgG F(c) fragment was produced by repeated immunization with Mouse IgG F(c) fragment in goat. |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
GLUT4 (SLC2A4) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Immunogen | A 12 amino acid peptide corresponding to the carboxyl terminus of the insulin regulatable glucose transporter conjugated to Keyhole Limpet Hemocyanin |
Collagen IV (COL4A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen Type IV from Human and Bovine placenta. |
XDH rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Xanthine Oxidase is isolated and purified from Bovine buttermilk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
MonoMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
TriMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic tri-methylated peptide corresponding to residues surrounding K36 of human histone H3 |
MonoMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
USD 415.00
2 Weeks
Adeno-Associated Virus 2 / AAV2 (VP1 + VP2 + VP3) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IP, WB |
| Immunogen | Recombinant adeno-associated virus (AAV-2) capsid proteins, expressed in baculovirus. |
AKR1C3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKR1C3 |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ |
Rabbit Polyclonal Anti-WDR5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI |
p53 (TP53) sheep polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | GST p53 fusion protein containing amino acids 1-393 of human p53. |
LDH5 M4 Isozyme rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | L-Lactic dehydrogenase, LDH-5(M4) isoenzyme is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Active filters
Applications
- IP
Clonalities
- Polyclonal
Filter by
Target Symbol
- C3 (20)
- ALB (19)
- H3-4 (18)
- LTF (10)
- MDH1 (9)
- TP53 (9)
- EGFR (8)
- HIST1H3A (8)
- AKT1 (7)
- C2 (7)
- CA1 (6)
- GALM (6)
- HISTONE H3 (6)
- LDHA (6)
- LDHB (6)
- RNASE1 (6)
- CP (5)
- CTNNB1 (5)
- GSK3B (5)
- H3C1 (5)
- PLG (5)
- S PROTEIN (5)
- TF (5)
- CAT (4)
- CDK1 (4)
- COL6A1 (4)
- CREB1 (4)
- EIF4EBP1 (4)
- GLUD1 (4)
- GRIA2 (4)
- JUN (4)
- NF2 (4)
- PGA5 (4)
- RELA (4)
- SOD1 (4)
- SQSTM1 (4)
- STAT3 (4)
- XRCC5 (4)
- ALDOA (3)
- BAX (3)
- BCHE (3)
- C1QA (3)
- CCND1 (3)
- CDC37 (3)
- CDK2 (3)
- CDKN1A (3)
- CES1 (3)
- COL1A1 (3)
- COL5A1 (3)
- CPA1 (3)
- CS (3)
- CTCF (3)
- CTSC (3)
- DDB1 (3)
- ENO3 (3)
- EPHB1 (3)
- EZH2 (3)
- FADD (3)
- FUCA1 (3)
- GAPDH (3)
- H2BC3 (3)
- HADH (3)
- HIF1A (3)
- HIST3H3 (3)
- HSPB1 (3)
- IGF2BP3 (3)
- ISL1 (3)
- KCNH2 (3)
- LMNB1 (3)
- LPO (3)
- MAPK14 (3)
- MCM5 (3)
- MCM7 (3)
- NSF (3)
- PDHA1 (3)
- PGAM2 (3)
- PGM1 (3)
- PLA2G1B (3)
- POLR2A (3)
- PPP2CA (3)
- ROCK1 (3)
- RPS6KA1 (3)
- RRM1 (3)
- STAT1 (3)
- SUCLG1 (3)
- TRF (3)
- UGDH (3)
- YAP1 (3)
- ACLY (2)
- ACPP (2)
- ACSS2 (2)
- ADA (2)
- AK4 (2)
- ALKBH1 (2)
- ARG1 (2)
- ATRIP (2)
- BAK1 (2)
- BCL2 (2)
- BCL2L1 (2)
- C5 (2)
Reactivities
- Human (958)
- Mouse (786)
- Rat (687)
- Other (Wide Range) (22)
- Bovine (17)
- Monkey (12)
- Chicken (9)
- Pig (7)
- SARS-CoV-2 (7)
- Zebrafish (6)
- Rhesus Monkey (5)
- Xenopus (5)
- X. tropicalis (4)
- Dog (3)
- Hamster (3)
- Sheep (3)
- Broad (2)
- Fusion proteins containing the Flag Tag (2)
- Primate (2)
- C. elegans (1)
- Canine (1)
- Cow (1)
- Feline (1)
- Fish (1)
- Goat (1)
- Guinea Pig (1)
- Rabbit (1)
- Saccharomyces cerevisiae (1)
- Streptococcus Pyogenes (1)
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (347)
- Phospho S15 (2)
- Phospho S727 (2)
- Phospho S9 (2)
- Phospho-specific (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K27 (1)
- Acetyl K5 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- MonoMethyl K36 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S157 (1)
- Phospho S2 (1)
- Phospho S21 (1)
- Phospho S22 (1)
- Phospho S240/244 (1)
- Phospho S259 (1)
- Phospho S298 (1)
- Phospho S33 (1)
- Phospho S380 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S473 (1)
- Phospho S51 (1)
- Phospho S621 (1)
- Phospho S65 (1)
- Phospho S82 (1)
- Phospho S957 (1)
- Phospho T183/T172 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T359 (1)
- Phospho T669 (1)
- Phospho Y1068 (1)
- Phospho Y15 (1)
- Phospho Y416/Y416 (1)
- TriMethyl K56 (1)
- pan-Mono-Methyl K (1)
- pan-tri-Methyl K (1)
Assay Types
Families
- Druggable Genome (249)
- Secreted Protein (59)
- Transcription Factors (58)
- Transmembrane (50)
- Protease (36)
- Protein Kinase (27)
- Stem cell - Pluripotency (25)
- ES Cell Differentiation/IPS (16)
- Phosphatase (8)
- Nuclear Hormone Receptor (4)
- Adult stem cells (3)
- Cancer stem cells (2)
- Embryonic stem cells (2)
- GPCR (2)
- Induced pluripotent stem cells (2)
- Ion Channels: Potassium (2)
- Ion Channels: Transient receptor potential (2)
- Stem cell relevant signaling - JAK/STAT signaling pathway (2)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)
- Ion Channels: Calcium (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Systemic lupus erythematosus (52)
- Complement and coagulation cascades (34)
- Pathways in cancer (34)
- Metabolic pathways (30)
- Focal adhesion (24)
- MAPK signaling pathway (22)
- Cell cycle (19)
- Chronic myeloid leukemia (14)
- Insulin signaling pathway (14)
- Neurotrophin signaling pathway (14)
- Huntington's disease (13)
- Prostate cancer (13)
- Acute myeloid leukemia (12)
- ECM-receptor interaction (12)
- Small cell lung cancer (12)
- Toll-like receptor signaling pathway (12)
- Colorectal cancer (11)
- T cell receptor signaling pathway (11)
- Adipocytokine signaling pathway (10)
- Apoptosis (10)
- ErbB signaling pathway (10)
- Glycolysis / Gluconeogenesis (10)
- Oocyte meiosis (10)
- Pyruvate metabolism (10)
- mTOR signaling pathway (10)
- Endocytosis (9)
- Gap junction (9)
- Prion diseases (9)
- Regulation of actin cytoskeleton (9)
- TGF-beta signaling pathway (9)
- Tight junction (9)
- Wnt signaling pathway (9)
- Chemokine signaling pathway (8)
- Citrate cycle (TCA cycle) (8)
- Cytokine-cytokine receptor interaction (8)
- Endometrial cancer (8)
- Glioma (8)
- Leukocyte transendothelial migration (8)
- Neuroactive ligand-receptor interaction (8)
- Pancreatic cancer (8)
- Pathogenic Escherichia coli infection (8)
- RIG-I-like receptor signaling pathway (8)
- Renal cell carcinoma (8)
- Amyotrophic lateral sclerosis (ALS) (7)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- B cell receptor signaling pathway (7)
- DNA replication (7)
- Progesterone-mediated oocyte maturation (7)
- Adherens junction (6)
- Axon guidance (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Fc epsilon RI signaling pathway (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Melanogenesis (6)
- Melanoma (6)
- Natural killer cell mediated cytotoxicity (6)
- Non-small cell lung cancer (6)
- Notch signaling pathway (6)
- Porphyrin and chlorophyll metabolism (6)
- RNA degradation (6)
- VEGF signaling pathway (6)
- Alzheimer's disease (5)
- Dilated cardiomyopathy (5)
- Fc gamma R-mediated phagocytosis (5)
- GnRH signaling pathway (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Jak-STAT signaling pathway (5)
- Long-term potentiation (5)
- NOD-like receptor signaling pathway (5)
- Non-homologous end-joining (5)
- Nucleotide excision repair (5)
- Proteasome (5)
- Purine metabolism (5)
- Pyrimidine metabolism (5)
- Spliceosome (5)
- Thyroid cancer (5)
- Ubiquitin mediated proteolysis (5)
- Vascular smooth muscle contraction (5)
- Bladder cancer (4)
- Calcium signaling pathway (4)
- Hematopoietic cell lineage (4)
- PPAR signaling pathway (4)
- p53 signaling pathway (4)
- Basal cell carcinoma (3)
- Cell adhesion molecules (CAMs) (3)
- Cytosolic DNA-sensing pathway (3)
- Long-term depression (3)
- Nitrogen metabolism (3)
- Parkinson's disease (3)
- Primary immunodeficiency (3)
- Propanoate metabolism (3)
- RNA polymerase (3)
- Type II diabetes mellitus (3)
- Vibrio cholerae infection (3)
- Antigen processing and presentation (2)
- Butanoate metabolism (2)
- Cysteine and methionine metabolism (2)
- Fatty acid metabolism (2)
- Glycine (2)
- Histidine metabolism (2)
- Homologous recombination (2)
- Lysine degradation (2)
- Mismatch repair (2)
- Riboflavin metabolism (2)
- Selenoamino acid metabolism (2)
- Taste transduction (2)
- Valine (2)
- Viral myocarditis (2)
- serine and threonine metabolism (2)
- Alanine (1)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Androgen and estrogen metabolism (1)
- Arachidonic acid metabolism (1)
- Arginine and proline metabolism (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cardiac muscle contraction (1)
- Cyanoamino acid metabolism (1)
- Dorso-ventral axis formation (1)
- Fatty acid biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Folate biosynthesis (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Limonene and pinene degradation (1)
- Lysosome (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Methane metabolism (1)
- One carbon pool by folate (1)
- Oxidative phosphorylation (1)
- Regulation of autophagy (1)
- SNARE interactions in vesicular transport (1)
- Starch and sucrose metabolism (1)
- Tryptophan metabolism (1)
- Type I diabetes mellitus (1)
- Tyrosine metabolism (1)
- aspartate and glutamate metabolism (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)