Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Phospho-KDR-Y1175 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Residues corresponding to the kinase insert or C-terminus of mouse VEGF Receptor 2 (residues 1158-1365). [Swiss-Prot# P35918] |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
USD 465.00
2 Weeks
SRC (N-term) (incl. pos. control) mouse monoclonal antibody, clone 11F1, Purified
| Applications | ELISA, WB |
| Reactivities | Canine, Human, Mouse, Rat |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-MYLK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYLK2 |
Germany
Japan
United Kingdom
China
