Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
Rabbit monoclonal antibody against AMPK alpha-1(Y365)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAA1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKAA1 |
Mouse Monoclonal AMPK alpha 1 Antibody (2B7)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit polyclonal APG1 (ULK1) Antibody (Center)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1). |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 450-500 of Human AMPKα1. |
AMPK alpha 2 (PRKAA2) (Center)/(Thr172) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 145-173 amino acids from the Central region of human PRKAA2 (Thr172) |
Rabbit Polyclonal antibody to ULK2 (unc-51-like kinase 2 (C. elegans))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 693 and 968 of ULK2 (Uniprot ID#Q8IYT8) |
Rabbit Polyclonal ULK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 . |
Anti-PRKAA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to N terminal 14 amino acids of human protein kinase, AMP-activated, alpha 1 catalytic subunit |
AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S). |
AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S). |
ULK1 rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from Human Unc-51-like kinase 1 (ULK1) |
Rabbit Polyclonal antibody to PIK3R4 (phosphoinositide-3-kinase, regulatory subunit 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 381 of PIK3R4 (Uniprot ID#Q99570) |
Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S). |
Modifications | Phospho-specific |
Rabbit Polyclonal ULK2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ULK2 antibody was raised against a 17 amino acid peptide near the center of human ULK2 . |
Rabbit polyclonal ULK2 Antibody (Center S323)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ULK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-327 amino acids from the Central region of human ULK2. |
Rabbit Polyclonal AMPK1 (Ser485) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 around the phosphorylation site of Serine 485 |
Modifications | Phospho-specific |
Rabbit Polyclonal ULK3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ULK3 antibody was raised against a 19 amino acid peptide near the center of human ULK3. |
Rabbit Polyclonal AMPK1 Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 |
Rabbit Polyclonal AMPK alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha |
AMPK alpha 1 (PRKAA1) pSer486 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide derived from Human AMPKα1 around the phosphorylation site of Serine 486. |
AMPK alpha 1 (PRKAA1) pThr174 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Goat Anti-PRKAA2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2. |
Rabbit Polyclonal Phospho-AMPK alpha (Thr172) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha around the phosphorylation site of Threonine 172 |
Modifications | Phospho-specific |
Rabbit Polyclonal ULK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN. |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S). |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S). |
AMPK alpha 1 (PRKAA1) pSer486 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide derived from human AMPKα1 around the phosphorylation site of Serine 486. |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 470-520 of Human AMPKα1. |
Goat Polyclonal Antibody against ULK3 (aa445-458)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KMRESRWEADTLDK, from the C Terminus of the protein sequence according to NP_001092906.1. |
Phospho-PRKAA1-T174/T172 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T174/T172 of human PRKAA1 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PIK3R4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL |
Rabbit Polyclonal Anti-ULK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL |
Rabbit anti AMPKa(pS79) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -CGSPN- with a phosphorylation site at Ser79 of AMPK alpha 1 protein from Carassius Auratus origin. This sequence is identical among human, mouse, rat, chicken, bovine, dog, and insect species. |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Goat Anti-PRKAA2, Biotinylated Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPLDALNTTKP., from the internal region of the protein sequence according to NP_006243.2. |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PRKAA2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
Anti-PRKAA2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
Rabbit Polyclonal Anti-PRKAA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PRKAA1 |
Rabbit Polyclonal Anti-PIK3R4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIK3R4 |
ULK3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ULK3 |
USD 379.00
In Stock
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |