Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against SAT1
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
| Applications | FC, IHC, WB |
| Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
TA336650 is a possible alternative to TA336566.
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal SREBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Mouse Monoclonal Beclin 1/ATG6 Antibody (9B6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Equine, Porcin |
| Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal Pyruvate Carboxylase Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Rabbit Polyclonal Perilipin Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Mouse Monoclonal VEGF Antibody (VG76e)
| Applications | IHC, WB |
| Reactivities | Human, Bovine, Porcine, Sheep |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Mouse Monoclonal anti-RHO Antibody
| Applications | IF |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit Polyclonal TLR5 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit Polyclonal Antibody against TIP47
| Applications | WB |
| Reactivities | Human, Primate, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the C-terminus (within residues 350-435) of the human TIP47 protein. [Swiss-Prot# O60664] |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal LRRK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region, within residues 2507–2527 of the human LRRK2 protein, conjugated to KLH. [Swiss-Prot# Q5S007] |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Murine, Rat, Porcine, Ovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
Active filters
Reactivities
- Porcine
Families
- Druggable Genome
Filter by
Category
Target Symbol
- CANX (4)
- DCX (3)
- INS (3)
- KCNA2 (3)
- BECN1 (2)
- HNRNPM (2)
- LOX (2)
- NEFH (2)
- UCHL1 (2)
- VEGFA (2)
- ACAT1 (1)
- ACAT2 (1)
- AQP2 (1)
- ATG5 (1)
- ATP1A1 (1)
- BCL2L1 (1)
- BEST1 (1)
- CALR (1)
- CELF1 (1)
- DUOX2 (1)
- EGR2 (1)
- FASN (1)
- GNAS (1)
- KDELR1 (1)
- LGR5 (1)
- LRRK2 (1)
- MKI67 (1)
- MUC1 (1)
- NEFL (1)
- NFKBIA (1)
- NPC1 (1)
- PC (1)
- PDIA3 (1)
- PIK3C3 (1)
- PLIN1 (1)
- PLIN2 (1)
- PLIN3 (1)
- PLK1 (1)
- PRKCA (1)
- RHO (1)
- RPE65 (1)
- SAG (1)
- SAT1 (1)
- SIAH1 (1)
- SIAH2 (1)
- SREBF1 (1)
- STX1A (1)
- TIMP2 (1)
- TLR5 (1)
- TUBA1A (1)
- TUBB (1)
- UBB (1)
Antibody Hosts
Clonalities
Conjugates
Pathways
- Regulation of autophagy (7)
- Antigen processing and presentation (6)
- Metabolic pathways (6)
- Insulin signaling pathway (5)
- Pathways in cancer (5)
- mTOR signaling pathway (5)
- Amyotrophic lateral sclerosis (ALS) (4)
- Gap junction (4)
- Oocyte meiosis (4)
- Parkinson's disease (4)
- Pathogenic Escherichia coli infection (4)
- Progesterone-mediated oocyte maturation (4)
- Prostate cancer (4)
- Focal adhesion (3)
- Maturity onset diabetes of the young (3)
- Pancreatic cancer (3)
- Pyruvate metabolism (3)
- Regulation of actin cytoskeleton (3)
- Type I diabetes mellitus (3)
- Type II diabetes mellitus (3)
- VEGF signaling pathway (3)
- Vibrio cholerae infection (3)
- Apoptosis (2)
- Bladder cancer (2)
- Butanoate metabolism (2)
- Calcium signaling pathway (2)
- Chronic myeloid leukemia (2)
- Cytokine-cytokine receptor interaction (2)
- Fatty acid metabolism (2)
- GnRH signaling pathway (2)
- Long-term depression (2)
- Lysine degradation (2)
- Melanogenesis (2)
- Phosphatidylinositol signaling system (2)
- Propanoate metabolism (2)
- RIG-I-like receptor signaling pathway (2)
- Renal cell carcinoma (2)
- Small cell lung cancer (2)
- Spliceosome (2)
- Synthesis and degradation of ketone bodies (2)
- Terpenoid backbone biosynthesis (2)
- Toll-like receptor signaling pathway (2)
- Tryptophan metabolism (2)
- Valine (2)
- Vascular smooth muscle contraction (2)
- Wnt signaling pathway (2)
- leucine and isoleucine degradation (2)
- Adipocytokine signaling pathway (1)
- Arginine and proline metabolism (1)
- B cell receptor signaling pathway (1)
- Cardiac muscle contraction (1)
- Cell cycle (1)
- Chemokine signaling pathway (1)
- Citrate cycle (TCA cycle) (1)
- Cytosolic DNA-sensing pathway (1)
- Dilated cardiomyopathy (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Fatty acid biosynthesis (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Glioma (1)
- Inositol phosphate metabolism (1)
- Jak-STAT signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Long-term potentiation (1)
- Lysosome (1)
- MAPK signaling pathway (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- PPAR signaling pathway (1)
- Retinol metabolism (1)
- SNARE interactions in vesicular transport (1)
- T cell receptor signaling pathway (1)
- Taste transduction (1)
- Tight junction (1)
- Ubiquitin mediated proteolysis (1)
- p53 signaling pathway (1)