Products

Primary Antibodies (1196)
Download

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C

Rabbit Polyclonal Anti-DUSP10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP10

USD 300.00

In Stock

Goat Polyclonal Anti-CD45 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli.

Rabbit Polyclonal Anti-DUSP13 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP13

Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Polyclonal Anti-DUSP19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP19

Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318
Modifications Phospho-specific

Rabbit anti-PPP1CB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CB

Rabbit Polyclonal Anti-RSPO3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RSPO3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human RSPO3.

Rabbit polyclonal His6-DEP-1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Poly-HIS protein were used to produced this antibody.

PTPN2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTPN2

Rabbit anti-PPP2R2A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R2A

Rabbit Polyclonal Anti-PPP1R10 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R10 antibody: synthetic peptide directed towards the N terminal of human PPP1R10. Synthetic peptide located within the following region: SQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKP

CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified

Applications FC, IF, IHC
Reactivities Human

CDKN3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CDKN3

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE

Rabbit Polyclonal Anti-NDST2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NDST2 antibody was raised against a 16 amino acid peptide near the amino terminus of human NDST2

Rabbit Polyclonal Anti-DUSP22 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP22

Rabbit Polyclonal Anti-DUSP14 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP14

Mouse anti pTEN Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

PPP3CA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP3CA

Rabbit anti-PTPN6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTPN6

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Rabbit Polyclonal Anti-CTDSPL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC

Acid Phosphatase (ACP1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 33~61 amino acids from the N-terminal region of human ACP1

Rabbit Polyclonal antibody to DUSP26 (dual specificity phosphatase 26 (putative))

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 117 of DUSP26 (Uniprot ID#Q9BV47)

Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Rabbit Polyclonal Anti-PPP2R5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW

Goat Polyclonal Anti-DUSP6 / MKP3 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-DUSP6 / MKP3 Antibody: Peptide with sequence C-PSNQNVYQVDSLQST, from the C Terminus of the protein sequence according to NP_001937.2; NP_073143.2.

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

PPM1H (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 235~263 amino acids from the Central region of Human PPM1H

Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873)

Rabbit Polyclonal antibody to SET (SET nuclear oncogene)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of SET

Rabbit polyclonal MKP1 (Ab-359) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MKP1 around the phosphorylation site of serine 359 (L-Q-SP-P-I).

Anti-PTPRK Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

CDC25A Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC25A

Rabbit anti-PPP1CA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CA

Rabbit Polyclonal Anti-PPP2R2C Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp2r2c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY

DUSP6 mouse monoclonal antibody, clone 3G2

Applications ELISA, IF, IHC, RNAi, WB
Reactivities Human

Rabbit monoclonal antibody against Cdc25C(E302)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to DUSP6 (dual specificity phosphatase 6)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 82 and 370 of DUSP6 (Uniprot ID#Q16828)

Rabbit polyclonal anti-DUSP6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DUSP6.

CDC25C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC25C

Rabbit anti-PPP2R1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A

Rabbit anti-PPM1D Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPM1D

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP