Germany
Japan
United Kingdom
China
Primary Antibodies
Download
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
PF4 mouse monoclonal antibody, clone KKO, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Goat Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
IL12A mouse monoclonal antibody, Azide Free
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA. |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Active filters
Applications
- WB
Families
- Secreted Protein
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (156)
- CD40 (60)
- CSF3 (57)
- CSF2 (49)
- VEGFA (48)
- IL20 (46)
- TNF (38)
- TNFRSF18 (37)
- PRL (33)
- IL1A (32)
- IL6 (31)
- IL24 (27)
- IFNG (26)
- CSF1 (25)
- CSF2RA (25)
- IL17B (25)
- VEGFB (24)
- VEGFD (24)
- IL2 (21)
- IL12A (20)
- CXCL8 (19)
- IL15RA (19)
- FLT1 (18)
- IL25 (18)
- TGFB1 (18)
- EPOR (17)
- FAS (17)
- IL1B (17)
- IL17A (15)
- CCL2 (14)
- CCL5 (14)
- IL15 (14)
- IL3 (14)
- CXCL12 (13)
- IL12B (13)
- IL4 (13)
- IFNL1 (11)
- IL10 (11)
- IL7 (11)
- EPO (10)
- FLT3LG (10)
- GH2 (10)
- TNFSF13B (10)
- TNFSF14 (10)
- VEGFC (10)
- IL9 (9)
- TNFSF13 (9)
- CCL3 (8)
- CRLF2 (8)
- IFNB1 (8)
- IL19 (8)
- TNFRSF1A (8)
- BMP2 (7)
- CCL28 (7)
- EDA (7)
- IFNA2 (7)
- IL13 (7)
- IL22 (7)
- IL6ST (7)
- TNFRSF11B (7)
- TNFRSF1B (7)
- CCL11 (6)
- CCL19 (6)
- FASLG (6)
- IFNA6 (6)
- IL21 (6)
- INHBA (6)
- OSM (6)
- BMP7 (5)
- CCL7 (5)
- CD40LG (5)
- CXCL1 (5)
- IFNL2 (5)
- IFNL3 (5)
- IL23A (5)
- IL4R (5)
- LEP (5)
- PF4 (5)
- TGFB2 (5)
- TGFB3 (5)
- TNFSF12 (5)
- CCL20 (4)
- CLCF1 (4)
- CTF1 (4)
- CX3CL1 (4)
- IL18 (4)
- IL5 (4)
- INHBC (4)
- LIF (4)
- TNFRSF6B (4)
- AMH (3)
- CCL16 (3)
- CCL17 (3)
- CSF3R (3)
- CXCL10 (3)
- CXCL14 (3)
- IL11 (3)
- IL1RAP (3)
- IL22RA2 (3)
- IL26 (3)