Primary Antibodies

View as table Download

CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Primate

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal Anti-ITGB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB3

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1

Rabbit anti-EMD Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human EMD

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.

Rabbit polyclonal anti-SGCA antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SGCA.

Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514)

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ITGAV Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ITGAV

Integrin alpha 3 (ITGA3) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 500-550 of Human Integrin α3

Rabbit Polyclonal TGFβ3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.

Rabbit polyclonal Anti-Ryanodine Receptor 2

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CAGESMSPGQGRNN, corresponding to amino acid residues 1489-1502 of human Ryanodine Receptor 2. Intracellular, N-terminus.

Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e)

Integrin alpha 4 (ITGA4) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to the C-terminal of human ITGA4

Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229)

Rabbit polyclonal Integrin Beta5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Integrin β5.

Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V).
Modifications Phospho-specific

Rabbit polyclonal anti-TGF beta3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β3.

Rabbit anti-ITGB5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ITGB5

Rabbit anti-ITGA2B Polyclonal Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ITGA2B

Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI

Rabbit Polyclonal Anti-Integrin beta-5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin beta-5 Antibody: A synthesized peptide derived from human Integrin beta-5

Rabbit Polyclonal Anti-Integrin aV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV

Rabbit Polyclonal Anti-Integrin a3 (CD49c) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin a3 (CD49c) Antibody: A synthesized peptide

Rabbit Polyclonal Anti-ACE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1

Rabbit Polyclonal Anti-Integrin β1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1

Rabbit Polyclonal Integrin alpha 6 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.

CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant

Applications IF, IHC, WB
Reactivities Human

TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified

Applications ELISA, FN, WB
Reactivities Human

Integrin alpha 1 (ITGA1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 727-755 amino acids from the Central region of human ITGA1.

beta Sarcoglycan (SGCB) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6.

Integrin alpha 4 (ITGA4) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide (GNSAGPKSMEVSC) from (C-term) of human NDRG1

TGF beta 3 (TGFB3) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the C-terminus of the precursor form of human TGF beta 3

CD51 (ITGAV) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ITGAV antibody was raised against synthetic peptide

CACNG8 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 90-119 amino acids from the N-terminal region of human CACNG8

ITGA8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1032-1061 amino acids from the C-terminal region of human ITGA8

Rabbit Polyclonal Emerin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Emerin antibody was raised against a 19 amino acid peptide from near the amino terminus of human Emerin.

Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698)

Rabbit polyclonal ITGA6 (light chain, Cleaved-Glu942) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGA6.
Modifications Phospho-specific