Germany
Japan
United Kingdom
China
USD 480.00
2 Weeks
Primary Antibodies
View as table Download
Rabbit polyclonal anti-GUSB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit Polyclonal AP3B2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AP3B2 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human AP3B2. The immunogen is located within the first 50 amino acids of AP3B2. |
Rabbit polyclonal GALNS Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS. |
Rabbit polyclonal LAMP1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LAMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 125-154 amino acids from the N-terminal region of human LAMP1. |
Rabbit anti-CTSH Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTSH |
Rabbit anti-TPP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TPP1 |
Rabbit anti-HEXA Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HEXA |
Rabbit Polyclonal Anti-GAA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
Rabbit Polyclonal Anti-ASAH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the middle region of human ASAH1. Synthetic peptide located within the following region: QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP |
Rabbit Polyclonal Anti-ACP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP5 antibody: synthetic peptide directed towards the N terminal of human ACP5. Synthetic peptide located within the following region: DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ |
Rabbit Polyclonal Anti-LAMP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT |
Rabbit Polyclonal Anti-SGSH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the C-terminal region of Human SGSH. Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP |
Rabbit Polyclonal Anti-Cathepsin G Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G |
Cathepsin D (CTSD) mouse monoclonal antibody, clone CP-D13, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human |
Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Cathepsin Z (CTSZ) mouse monoclonal antibody, clone AT6G11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Bovine, Human, Monkey, Porcine, Rabbit |
| Immunogen | KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK. |
Goat Polyclonal Antibody against Arylsulfatase A
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YDLSKDPGENYN, from the internal region of the protein sequence according to NP_000478.2. |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 44 and 230 of SGSH (Uniprot ID#P51688) |
Rabbit polyclonal antibody to MANBA (mannosidase, beta A, lysosomal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 380 and 654 of MANBA (Uniprot ID#O00462) |
Rabbit polyclonal antibody to V-ATPase 116 kDa isoform a4 (ATPase, H+ transporting, lysosomal V0 subunit a4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 53 and 295 of V-ATPase 116 kDa isoform a4 (Uniprot ID#Q9HBG4) |
Rabbit polyclonal Cathepsin D (light chain, Cleaved-Gly65) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cathepsin D AND light chain. |
Rabbit polyclonal Cathepsin D (heavy chain, Cleaved-Leu169) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATD. |
Rabbit polyclonal anti-Cathepsin D antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CTSD. |
Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL1. |
Rabbit polyclonal CATL2 (Cleaved-Leu114) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL2. |
Rabbit polyclonal CATZ (Cleaved-Leu62) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATZ. |
Rabbit Polyclonal Anti-SLC11A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC11A1 Antibody: synthetic peptide directed towards the C terminal of human SLC11A1. Synthetic peptide located within the following region: VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT |
Rabbit Polyclonal Anti-Ctns Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Ctns Antibody is: synthetic peptide directed towards the middle region of Mouse Ctns. Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP |
Rabbit Polyclonal Anti-GLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |
Active filters
Applications
- WB
Pathways
- Lysosome
Filter by
Category
Target Symbol
- CD68 (118)
- CD63 (61)
- CTSL (54)
- NEU1 (41)
- GBA (34)
- GLB1 (28)
- CLTA (23)
- NAGA (22)
- ARSB (20)
- LAMP1 (20)
- IDS (17)
- PPT1 (16)
- ARSG (15)
- CTSD (13)
- SMPD1 (11)
- SCARB2 (10)
- GGA2 (8)
- M6PR (8)
- SORT1 (8)
- ATP6V0D2 (7)
- CTSE (7)
- NAPSA (7)
- ACP5 (5)
- ARSA (5)
- ASAH1 (5)
- CTSG (5)
- CTSS (5)
- CTSV (5)
- CTSZ (5)
- PSAP (5)
- SGSH (5)
- AGA (4)
- AP3S1 (4)
- ATP6AP1 (4)
- CTSC (4)
- CTSK (4)
- DNASE2B (4)
- FUCA1 (4)
- GALNS (4)
- GUSB (4)
- IGF2R (4)
- LAMP2 (4)
- LAMP3 (4)
- SLC11A2 (4)
- TPP1 (4)
- ABCB9 (3)
- ACP2 (3)
- AP1G1 (3)
- AP1M1 (3)
- CTSH (3)
- GM2A (3)
- GNS (3)
- HEXA (3)
- LGMN (3)
- SLC11A1 (3)
- AP1B1 (2)
- AP4M1 (2)
- ATP6V0A1 (2)
- ATP6V0A2 (2)
- ATP6V0B (2)
- ATP6V0C (2)
- ATP6V0D1 (2)
- CLTB (2)
- CLTC (2)
- CTSB (2)
- CTSF (2)
- DNASE2 (2)
- GAA (2)
- GALC (2)
- GGA1 (2)
- GGA3 (2)
- GLA (2)
- HGSNAT (2)
- HYAL1 (2)
- IDUA (2)
- LAPTM4B (2)
- LIPA (2)
- NPC1 (2)
- TCIRG1 (2)
- ABCA2 (1)
- AP1M2 (1)
- AP1S2 (1)
- AP1S3 (1)
- AP3B1 (1)
- AP3B2 (1)
- AP3D1 (1)
- AP3M1 (1)
- AP3M2 (1)
- AP4B1 (1)
- ATP6V0A4 (1)
- ATP6V1H (1)
- CLN5 (1)
- CTNS (1)
- CTSO (1)
- CTSW (1)
- GNPTAB (1)
- HEXB (1)
- LAPTM4A (1)
- LAPTM5 (1)
- MANBA (1)