Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal Anti-CREB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CREB1 |
Goat Anti-CAMK2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRTAQSEETRVWHR, from the internal region of the protein sequence according to NP_057065.2; NP_741960.1. |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287 |
| Modifications | Phospho-specific |
Rabbit anti-GNAO1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAO1 |
Rabbit anti-PRKCB Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCB |
Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
Rabbit Polyclonal Anti-WNT8B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the N terminal of human WNT8B. Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG |
Rabbit Polyclonal Anti-CREB-BP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB-BP Antibody: A synthesized peptide derived from human CREB-BP |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
SCF (KITLG) mouse monoclonal antibody, clone hKL12, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Primate |
Active filters
Applications
- WB
Pathways
- Melanogenesis
Filter by
Target Symbol
- MAP2K1 (222)
- CTNNB1 (149)
- KIT (74)
- MAPK1 (68)
- KRAS (58)
- WNT3 (47)
- GNAS (46)
- HRAS (45)
- DVL2 (34)
- MAP2K2 (33)
- KITLG (29)
- RAF1 (29)
- CAMK2B (27)
- CREB1 (26)
- POMC (26)
- PRKCA (26)
- MAPK3 (22)
- GSK3B (17)
- NRAS (16)
- TYR (15)
- EP300 (12)
- MITF (12)
- PRKCB (12)
- GNAI1 (10)
- LEF1 (10)
- CAMK2A (8)
- PRKACA (8)
- TCF7 (8)
- BMP2 (7)
- WNT3A (7)
- CREBBP (6)
- PRKCG (6)
- WNT1 (6)
- DCT (5)
- EDNRB (5)
- FZD2 (5)
- FZD4 (5)
- GNAO1 (5)
- MC1R (5)
- CAMK2G (4)
- CREB3 (4)
- CREB3L1 (4)
- CREB3L2 (4)
- DVL1 (4)
- FZD1 (4)
- FZD9 (4)
- GNAI2 (4)
- PRKACB (4)
- TCF7L2 (4)
- WNT2B (4)
- WNT4 (4)
- WNT5B (4)
- WNT8B (4)
- WNT9A (4)
- WNT9B (4)
- ADCY1 (3)
- ADCY2 (3)
- CALM2 (3)
- CAMK2D (3)
- CREB3L4 (3)
- EDN1 (3)
- FZD10 (3)
- FZD6 (3)
- FZD8 (3)
- PLCB1 (3)
- PLCB3 (3)
- PRKX (3)
- TCF7L1 (3)
- TYRP1 (3)
- WNT10A (3)
- WNT10B (3)
- WNT16 (3)
- WNT5A (3)
- WNT6 (3)
- ADCY3 (2)
- ADCY4 (2)
- ADCY5 (2)
- ADCY6 (2)
- CALM3 (2)
- DVL3 (2)
- FZD3 (2)
- FZD5 (2)
- FZD7 (2)
- GNAI3 (2)
- GNAQ (2)
- PLCB2 (2)
- WNT2 (2)
- ADCY8 (1)
- ADCY9 (1)
- CALM1 (1)
- CALML3 (1)
- CALML6 (1)
- PRKACG (1)
- WNT11 (1)
- WNT8A (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1236)
- Protein Kinase (567)
- ES Cell Differentiation/IPS (362)
- Transmembrane (267)
- Transcription Factors (239)
- Secreted Protein (159)
- Adult stem cells (112)
- Embryonic stem cells (81)
- Stem cell - Pluripotency (74)
- GPCR (38)
- Cancer stem cells (33)
- Stem cell relevant signaling - Wnt Signaling pathway (26)
- Induced pluripotent stem cells (15)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (7)