Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
Modifications | Phospho-specific |
Rabbit Polyclonal Gli1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151] |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | AP |
Goat Polyclonal Antibody against FGF21
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1. |
BMP4 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide surrounding amino acid 395 of Human BMP-4 |
Rabbit monoclonal antibody against Phospho-c-Myc (pT58/S62)(E203) (phospho-specific)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
Mouse Monoclonal c-Myc Antibody (9E10)
Applications | WB |
Reactivities | Human, Mouse, Drosophila |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Rabbit Polyclonal MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Human |
Rabbit polyclonal anti-Gli-3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
purified MYC Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700496 |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | Assay, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
purified MYC Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700497 |
SMAD3 mouse monoclonal antibody, clone AF9F7, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Mammalian |
SMAD2 (181-280) mouse monoclonal antibody, clone 3G6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free
Applications | FC, FN |
Reactivities | Human |
c Kit (KIT) (41-140) mouse monoclonal antibody, clone 5F6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c-Myc (MYC) chicken polyclonal antibody, FITC
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | FITC |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared. |
BMP2 (+ BMP4) rabbit polyclonal antibody, Purified
Applications | ELISA, IP, WB |
Reactivities | Human |
Immunogen | Highly purified Synthetic peptide C-terminal (20 amino acids) of Human BMP-2/4. |
EGF rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF). |
EGF rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF). |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
Rabbit polyclonal anti-KGF/FGF-7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed human KGF/FGF-7 |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3. |
Modifications | Phospho-specific |
Rabbit polyclonal SMAD2 Antibody
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2. |
Rabbit polyclonal MYC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Myc. |
FGF10 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGF10 |
Mouse Monoclonal anti-c-Myc Antibody
Applications | WB |
Reactivities | Human and fusion proteins in All Species |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-GLI2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal c-Myc Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal Anti-MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
EGF mouse monoclonal antibody, clone S-146, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |