Primary Antibodies

View as table Download

Rabbit Monoclonal antibody against Gli-1 (GLI1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications Phospho-specific

Rabbit Polyclonal Gli1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP

Applications ELISA, IHC, WB
Reactivities Human
Conjugation HRP

EGF mouse monoclonal antibody, clone S-21, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP

Applications ELISA, IHC, WB
Reactivities Human
Conjugation AP

Goat Polyclonal Antibody against FGF21

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1.

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4

Rabbit monoclonal antibody against Phospho-c-Myc (pT58/S62)(E203) (phospho-specific)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Mouse Monoclonal c-Myc Antibody (9E10)

Applications WB
Reactivities Human, Mouse, Drosophila
Conjugation Unconjugated

EGF mouse monoclonal antibody, clone KT2, Aff - Purified

Applications ELISA
Reactivities Human

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

c-Myc (MYC) chicken polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Immunogen Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH.
The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%.

c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified

Applications IF, IHC, IP, WB

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified

Applications ELISA, FC, IHC, IP, WB
Reactivities Human

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

purified MYC Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F2

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700496

EGF mouse monoclonal antibody, clone S-147, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE

Applications FC
Reactivities Human
Conjugation PE

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified

Applications ELISA, FC, IHC, WB
Reactivities Human

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications Assay, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

purified MYC Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A6

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700497

SMAD3 mouse monoclonal antibody, clone AF9F7, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Mouse, Rat

c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat

c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified

Applications IF, IP, WB
Reactivities Mammalian

c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free

Applications FC, FN
Reactivities Human

c-Myc (MYC) chicken polyclonal antibody, FITC

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation FITC
Immunogen Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared.

BMP2 (+ BMP4) rabbit polyclonal antibody, Purified

Applications ELISA, IP, WB
Reactivities Human
Immunogen Highly purified Synthetic peptide C-terminal (20 amino acids) of Human BMP-2/4.

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Immunogen This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.

Rabbit polyclonal anti-KGF/FGF-7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human KGF/FGF-7

Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody

Applications IHC, WB
Reactivities Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein.

Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3.
Modifications Phospho-specific

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

FGF10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FGF10

Mouse Monoclonal anti-c-Myc Antibody

Applications WB
Reactivities Human and fusion proteins in All Species
Conjugation Unconjugated

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE

Rabbit Polyclonal c-Myc Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit Polyclonal Anti-MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

EGF mouse monoclonal antibody, clone S-146, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated