Germany
Japan
United Kingdom
China
GJB2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide mapping at the middle region of rat Connexin 26 |
Primary Antibodies
View as table Download
MRP4 (ABCC4) (70-82) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence from the N Terminus (near) of the protein sequence according to NP_005836.2, NP_001098985.1. |
CATSPER1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 35-65 amino acids from the N-terminal region of human CATSPER1 |
KCNE1L (KCNE5) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 67~96 amino acids from the Central region of Human KCE1L |
KCNMB1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 42-72 amino acids from the Central region of human KCNMB1 |
Goat Anti-CLCN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QQLDEPVNFSDCK, from the internal region of the protein sequence according to NP_004357.3. |
Goat Anti-NOX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EWHPFTISSAPEQKD, from the internal region of the protein sequence according to NP_078781.3; NP_001171708.1; NP_001171709.1. |
Rabbit polyclonal anti-CACNG1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal anti-GJA4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from nal of human GJA4. |
Rabbit polyclonal anti-CACNA2D4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
BEST4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | BEST4 antibody was raised against synthetic 15 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rabbit (93%); Hamster (87%); Pig (80%). |
Rabbit polyclonal VDAC/Porin antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | VDAC/Porin Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 185-197 of Human VDAC1/Porin1. |
Rabbit polyclonal CACNA2D3 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1026-1053 amino acids from the C-terminal region of human CACNA2D3. |
Rabbit Polyclonal Connexin 43 (Ser367) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Connexin 43 around the phosphorylation site of Serine 367 |
| Modifications | Phospho-specific |
Rabbit anti-CYBB Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYBB |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Rabbit Polyclonal Anti-CLCC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW |
Rabbit Polyclonal Anti-KCNIP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL |
Rabbit Polyclonal Anti-Cacng1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL |
Rabbit Polyclonal Anti-CACNA2D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI |
Rabbit Polyclonal Anti-Clcn1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV |
Rabbit Polyclonal Anti-CLIC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
Rabbit Polyclonal Anti-ACCN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN3 antibody: synthetic peptide directed towards the N terminal of human ACCN3. Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Rabbit Polyclonal Anti-CLCA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLCA2 antibody: synthetic peptide directed towards the C terminal of human CLCA2. Synthetic peptide located within the following region: RYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGNIQM |
Rabbit Polyclonal Anti-CLIC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Rabbit Polyclonal Anti-CLIC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Rabbit Polyclonal Anti-TPCN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1. Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL |
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the N terminal of human KCNH6. Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK |
Rabbit Polyclonal Anti-CACNG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA |
Rabbit Polyclonal Anti-TOMM40L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD |
Rabbit Polyclonal Anti-VMD2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VMD2L2 antibody: synthetic peptide directed towards the N terminal of human VMD2L2. Synthetic peptide located within the following region: MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY |
Rabbit Polyclonal Anti-KCTD6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCTD6 antibody: synthetic peptide directed towards the N terminal of human KCTD6. Synthetic peptide located within the following region: HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN |
Rabbit Polyclonal Anti-CATSPER2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the N terminal of human CATSPER2. Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA |
Rabbit Polyclonal Anti-KCNAB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: SSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS |
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL |
Rabbit Polyclonal Anti-KCNIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: ALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKE |
Rabbit Polyclonal Anti-KCNIP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS |
Active filters
Category
- Antibodies
Families
- Ion Channels: Other
Filter by
Target Symbol
- KCNAB1 (54)
- KCTD14 (45)
- KCNIP2 (42)
- FXYD3 (40)
- BEST3 (32)
- AQP1 (21)
- KCTD13 (21)
- GJA1 (20)
- NUDT9 (19)
- CACNB2 (18)
- TOMM40L (17)
- CACNB1 (12)
- CLIC1 (10)
- CLCA1 (9)
- CYBB (7)
- TNFAIP1 (7)
- TOMM40 (7)
- VDAC2 (7)
- CLIC4 (6)
- GJB1 (6)
- KCNH6 (6)
- VDAC1 (6)
- CACNB4 (5)
- FXYD5 (5)
- GJB2 (5)
- KCNIP4 (5)
- KCNMB2 (5)
- KCNMB3 (5)
- KCTD15 (5)
- KCTD5 (5)
- NOX1 (5)
- SCNN1A (5)
- ABCC4 (4)
- ASIC1 (4)
- ASIC2 (4)
- CACNG1 (4)
- CHRFAM7A (4)
- CLCC1 (4)
- CLIC3 (4)
- CLNS1A (4)
- GJA4 (4)
- GJC1 (4)
- KCNAB2 (4)
- NOX5 (4)
- ASIC4 (3)
- BEST1 (3)
- BEST4 (3)
- CACNA2D1 (3)
- CACNA2D2 (3)
- CACNA2D4 (3)
- CACNB3 (3)
- CACNG4 (3)
- CACNG6 (3)
- CATSPER2 (3)
- CLCN2 (3)
- CLCN4 (3)
- CLCN5 (3)
- CLIC5 (3)
- GJC2 (3)
- GJD2 (3)
- KCNE3 (3)
- KCNH7 (3)
- KCNMB1 (3)
- KCNMB4 (3)
- KCTD11 (3)
- KCTD6 (3)
- VDAC3 (3)
- CATSPER1 (2)
- CATSPER3 (2)
- CLCA4 (2)
- CLCN1 (2)
- CLCN3 (2)
- CLCN6 (2)
- CLIC2 (2)
- FXYD1 (2)
- FXYD7 (2)
- GJA3 (2)
- GJA8 (2)
- GJB4 (2)
- KCNIP1 (2)
- KCTD1 (2)
- KCTD10 (2)
- POLR2M (2)
- SCNN1B (2)
- SCNN1D (2)
- SCNN1G (2)
- SHKBP1 (2)
- TPCN2 (2)
- TTYH1 (2)
- ZACN (2)
- ASIC3 (1)
- ASIC5 (1)
- CACNA2D3 (1)
- CACNG3 (1)
- CACNG7 (1)
- CATSPER4 (1)
- CLCA2 (1)
- CLCN7 (1)
- GJB5 (1)
- KCNAB3 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (80)
- Cardiac muscle contraction (60)
- Dilated cardiomyopathy (60)
- Hypertrophic cardiomyopathy (HCM) (60)
- MAPK signaling pathway (60)
- Amyotrophic lateral sclerosis (ALS) (24)
- Gap junction (23)
- Purine metabolism (19)
- Calcium signaling pathway (16)
- Huntington's disease (16)
- Parkinson's disease (16)
- Vascular smooth muscle contraction (16)
- Taste transduction (13)
- Leukocyte transendothelial migration (12)
- Olfactory transduction (12)
- ABC transporters (4)