Primary Antibodies

View as table Download

Rabbit polyclonal anti-POLE4 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLE4.

Rabbit Polyclonal RFA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human RFA2

Rabbit Polyclonal RFA2 (Thr21) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human RFA2 around the phosphorylation site of Threonine 21
Modifications Phospho-specific

Rabbit anti-FEN1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FEN1

Rabbit Polyclonal Anti-RFC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human RFC2

DNA Ligase I (LIG1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PRIM1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MCM2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 656~685 amino acids from the C-terminal region of human MCM2

MCM6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 80-109 amino acids from the N-terminal region of Human MCM6.

RNase H2 subunit C (RNASEH2C) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 87~116 amino acids from the Center region of human RNH2C

Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340)

Rabbit polyclonal anti-POLD1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLD1.

Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S).
Modifications Phospho-specific

Anti-RPA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human replication protein A1, 70kDa

Rabbit polyclonal FEN1 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1.

Rabbit polyclonal POLE3 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This POLE3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-34 amino acids from the N-terminal region of human POLE3.

Rabbit Polyclonal MCM2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human MCM2.

Rabbit Polyclonal Anti-RFC5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE

Rabbit Polyclonal Anti-MCM3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Rabbit Polyclonal Anti-MCM7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV

DNA polymerase alpha (POLA1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 81-130 of Human DNA pol α.

POLD1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

DNA Ligase I (LIG1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DNA ligase 1

MCM7 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 113-142 amino acids from the N-terminal region of human MCM7

POLD3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 415-443 amino acids from the C-terminal region of human POLD3

RPA34 (RPA2) (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 74~103 amino acids from the N-terminal region of Human RPA2

Goat Anti-LIG1 / DNA ligase I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RVREDKQPEQATTS, from the internal region (near C-Terminus) of the protein sequence according to NP_000225.1.

Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A).
Modifications Phospho-specific

Rabbit polyclonal anti-POLD3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLD3.

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein.

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Algal
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 55-71 of Isochrysis galbana PCNA.

Rabbit polyclonal anti-MCM2 antibody

Applications WB
Reactivities Human, Mouse, Rat, S. cerevisiae
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 21-31 of human MCM2 protein (see below).

Goat Polyclonal RPA1/RPA70 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CKSYEDATKITVRSN (aa323-337), from the internal region of the protein sequence according to NP_002936.1

Rabbit polyclonal POLD2 Antibody (Center)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2.

Rabbit polyclonal Anti-PRIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRIM2 antibody: synthetic peptide directed towards the middle region of human PRIM2. Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS

Rabbit Polyclonal Anti-POLE3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POLE3 Antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS

Rabbit Polyclonal Anti-POLA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLA2 antibody is: synthetic peptide directed towards the N-terminal region of Human POLA2. Synthetic peptide located within the following region: VGLTSEILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEE

Rabbit Polyclonal Anti-RPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPA4 antibody: synthetic peptide directed towards the middle region of human RPA4. Synthetic peptide located within the following region: VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD

Rabbit Polyclonal Anti-RPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPA4 antibody: synthetic peptide directed towards the C terminal of human RPA4. Synthetic peptide located within the following region: HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

Rabbit Polyclonal Anti-LIG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Rabbit Polyclonal Anti-LIG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF

Rabbit Polyclonal Anti-PRIM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRIM1 antibody: synthetic peptide directed towards the N terminal of human PRIM1. Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Rabbit Polyclonal Anti-RFC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the C terminal of human RFC3. Synthetic peptide located within the following region: IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF

Rabbit Polyclonal Anti-RFC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the N terminal of human RFC3. Synthetic peptide located within the following region: YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Rabbit Polyclonal Anti-RFC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC4 antibody: synthetic peptide directed towards the middle region of human RFC4. Synthetic peptide located within the following region: DKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDK

Rabbit Polyclonal Anti-FEN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FEN1 antibody: synthetic peptide directed towards the C terminal of human FEN1. Synthetic peptide located within the following region: PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL

Rabbit Polyclonal Anti-DNA2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNA2L antibody: synthetic peptide directed towards the middle region of human DNA2L. Synthetic peptide located within the following region: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE

Rabbit Polyclonal Anti-MCM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK