Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Anti-KEAP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human kelch-like ECH-associated protein 1 |
Rabbit polyclonal antibody to UBE2G2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 165 of UBE2G2 (Uniprot ID#P60604) |
Rabbit anti-TTK Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TTK |
Rabbit Polyclonal XIAP (Ser87) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human XIAP around the phosphorylation site of Serine 87 |
| Modifications | Phospho-specific |
Rabbit anti-UBE2D1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UBE2D1 |
Goat Polyclonal Antibody against SOCS3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PIREFLDQYDAPL, from the C Terminus of the protein sequence according to NP_003946.3. |
Rabbit Polyclonal SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SOCS1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human SOCS1. |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
Rabbit Polyclonal Anti-Parkin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Parkin Antibody: A synthesized peptide derived from human Parkin |
Rabbit Polyclonal Anti-AOS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AOS1 Antibody: A synthesized peptide derived from human AOS1 |
Rabbit Polyclonal Anti-PIAS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS2 Antibody: A synthesized peptide derived from human PIAS2 |
Rabbit Polyclonal Anti-PIAS3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS3 Antibody: A synthesized peptide derived from human PIAS3 |
Rabbit Polyclonal Anti-TRI18 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRI18 Antibody: A synthesized peptide derived from human TRI18 |
Rabbit Polyclonal Anti-Keap1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keap1 Antibody: A synthesized peptide derived from human Keap1 |
Rabbit Polyclonal Anti-PDCL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PDCL antibody was raised against a 16 amino acid peptide near the amino terminus of human PDCL. |
Goat Polyclonal Anti-STUB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human STUB1 protein produced in E. coli. |
Goat Polyclonal Antibody against VHL
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSLVKPENYRRLD, from the internal region of the protein sequence according to NP_000542.1; NP_937799.1. |
Active filters
Reactivities
- Rat
Conjugates
- Unconjugated
Pathways
- Ubiquitin mediated proteolysis
Filter by
Category
Target Symbol
- UBE2E3 (57)
- SOCS3 (37)
- UBE2G2 (31)
- FBXW7 (30)
- UBE2J1 (27)
- UBE2D2 (25)
- SAE1 (23)
- MGRN1 (21)
- ANAPC11 (19)
- BTRC (19)
- ANAPC2 (18)
- UBE2S (17)
- KEAP1 (14)
- ERCC8 (12)
- UBA3 (12)
- PIAS2 (10)
- SMURF2 (10)
- CUL4B (9)
- SOCS1 (9)
- VHL (8)
- DDB1 (6)
- UBE3B (6)
- CBL (5)
- TRAF6 (5)
- UBE2B (5)
- UBE2D1 (5)
- XIAP (5)
- AIRE (4)
- BIRC6 (4)
- CUL3 (4)
- PRKN (4)
- SIAH1 (4)
- UBE2I (4)
- ANAPC10 (3)
- BIRC2 (3)
- BRCA1 (3)
- CDC20 (3)
- CDC27 (3)
- MAP3K1 (3)
- PIAS3 (3)
- STUB1 (3)
- UBA2 (3)
- UBE2D4 (3)
- UBE2L3 (3)
- UBE2M (3)
- ANAPC5 (2)
- CUL4A (2)
- ITCH (2)
- MDM2 (2)
- MID1 (2)
- PIAS1 (2)
- SKP1 (2)
- SYVN1 (2)
- TRIM32 (2)
- UBA1 (2)
- UBE2C (2)
- ANAPC1 (1)
- ANAPC13 (1)
- ANAPC4 (1)
- ANAPC7 (1)
- CDC16 (1)
- CDC23 (1)
- CDC26 (1)
- CDC34 (1)
- CUL1 (1)
- CUL2 (1)
- CUL5 (1)
- CUL7 (1)
- DDB2 (1)
- ELOC (1)
- FANCL (1)
- FBXO2 (1)
- FBXO4 (1)
- HUWE1 (1)
- PIAS4 (1)
- PML (1)
- RCHY1 (1)
- RHOBTB2 (1)
- SMURF1 (1)
- TTK (1)
- UBE2E1 (1)
- UBE2J2 (1)
- UBE2K (1)
- UBE2N (1)
- UBE2Z (1)
- UBR5 (1)