Rabbit Polyclonal H3R17me2(asym)K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3R17me2(asym)K18ac antibody: the region of histone H3 containing the asymmetrically dimethylated R17 and the acetylated lysine 18 (H3R17me2(asym)K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K5,8,12ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K5,8,12ac antibody: the region of histone H4 containing the acetylated lysines 5, 8 and 12 (H4K5,8,12ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K20me3 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K20me3 antibody: the region of histone H4 containing the trimethylated lysine 20 (H4K20me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal Betatrophin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Betatrophin antibody was raised against a 16 amino acid peptide near the amino terminus of human Betatrophin. The immunogen is located within amino acids 40 - 90 of Betatrophin. |
Rabbit Polyclonal H3K9me1 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me1 antibody: histone H3 containing the monomethylated lysine 9 (H3K9me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9acS10p Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9acS10p antibody: histone H3 containing the acetylated lysine 9 and the phosphorylated serine 10 (H3K9acS10p), using a KLH-conjugated synthetic peptide |
Rabbit Polyclonal H3K9me3S10p Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me3S10p antibody: histone H3 containing trimethylated lysine 9 and the phosphorylated serine 10 (H3K9me3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me1 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me1 antibody: histone H3 containing the monomethylated lysine 27 (H3K27me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me2 antibody: the histone H3, dimethylated at lysine 27 (H3K27me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9me3 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me3 antibody: the region of histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K36me1 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K36me1 antibody: histone H3 containing the monomethylated lysine 36 (H3K36me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human LSD1 (Lysine-specific demethylase 1), using a KLH-conjugated synthetic peptide from the inner part of the protein. |
NOS1 (134-148) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal H3K4me3 Antibody
| Applications | Dot, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K5,8,12,16ac Antibody
| Applications | Dot, ELISA, IF |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K5,8,12,16ac antibody: the region of histone H4 containing the acetylated lysines 5, 8, 12 and 16 (H4K5,8,12,16ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 17 amino acid peptide near the amino terminus of human PPARGC1A. The immunogen is located within amino acids 200 - 250 of PPARGC1A. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
XRCC2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human XRCC2 |
Rabbit Polyclonal Anti-CENPN Antibody - middle region
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CENPN antibody: synthetic peptide directed towards the middle region of human CENPN. Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS |
Rabbit Polyclonal Anti-DAF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF. |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Germany
Japan
United Kingdom
China
