Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal H3K27me3S28p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me3 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3 antibody: against histone H3, trimethylated at lysine 27 (H3K27me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Rabbit Polyclonal H3K36me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K36me2 antibody: histone H3 containing the dimethylated lysine 36 (H3K36me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K4me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K4me2 antibody: histone H3 containing the dimethylated lysine 4 (H3K4me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K79me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K79me2 antibody: the region of histone H3 containing the dimethylated lysine 79 (H3K79me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K18ac antibody: the region of histone H3 containing the acetylated lysine 18 (H3K18ac), using a KLH-conjugated synthetic peptide. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IF
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Filter by
Target Symbol
- H3C1 (30)
- HISTONE H3 (18)
- HIST2H3A (15)
- AKT1 (14)
- SQSTM1 (12)
- STAT3 (12)
- BAX (10)
- MAP1LC3B (10)
- RELA (10)
- RB1 (9)
- BCL2 (8)
- IRF3 (8)
- IRS1 (8)
- MAPT (8)
- TARDBP (8)
- TP53 (8)
- APP (7)
- ATG7 (7)
- CASP3 (7)
- GAPDH (7)
- HISTONE H4 (7)
- KDM1A (7)
- RPS6KA1 (7)
- SMAD2 (7)
- AKT2 (6)
- ATG5 (6)
- CBX5 (6)
- EGFR (6)
- ENO2 (6)
- HDAC5 (6)
- HIST1H3A (6)
- HSP90AB1 (6)
- HSPD1 (6)
- JUN (6)
- KLF4 (6)
- LAMP1 (6)
- MKI67 (6)
- MTOR (6)
- NFKBIA (6)
- PYCARD (6)
- SCARB1 (6)
- BBC3 (5)
- BCL2L11 (5)
- BRCA1 (5)
- CALR (5)
- CANX (5)
- CASP9 (5)
- CCNB1 (5)
- CDKN2A (5)
- CHEK2 (5)
- COL1A2 (5)
- EIF4E (5)
- FASN (5)
- FOXO1 (5)
- FOXO4 (5)
- GSK3B (5)
- HDAC2 (5)
- HIF1A (5)
- HISTONE H2A (5)
- HSP90AA1 (5)
- HSPA1A (5)
- HSPA5 (5)
- HSPB1 (5)
- IKBKG (5)
- KDR (5)
- MAP1LC3A (5)
- MAPK1 (5)
- MAPK14 (5)
- MCL1 (5)
- MEF2A (5)
- NANOG (5)
- NPM1 (5)
- PECAM1 (5)
- PKM (5)
- PPARGC1A (5)
- PRKACA (5)
- PTEN (5)
- RHOA (5)
- RPS6KB1 (5)
- SMAD3 (5)
- SNCA (5)
- SOX2 (5)
- STMN1 (5)
- SUMO1 (5)
- TFAM (5)
- TGFB1 (5)
- TLR4 (5)
- TNFAIP3 (5)
- ACE2 (4)
- ACTB (4)
- AGR2 (4)
- AIPL1 (4)
- ALK (4)
- AMBRA1 (4)
- ANP32A (4)
- AQP2 (4)
- ARAF (4)
- ATF6 (4)
- ATG16L1 (4)
- AXIN2 (4)
Isotypes
Knockout (KO) Validation
Modifications
- Unmodified (2430)
- Phospho-specific (138)
- Acetyl K5 (3)
- Acetyl K12 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S70 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (2155)
- Transmembrane (1069)
- Transcription Factors (550)
- Protein Kinase (274)
- Secreted Protein (247)
- ES Cell Differentiation/IPS (201)
- GPCR (184)
- Stem cell - Pluripotency (171)
- Protease (94)
- Embryonic stem cells (50)
- Adult stem cells (41)
- Induced pluripotent stem cells (36)
- Nuclear Hormone Receptor (31)
- Phosphatase (27)
- Cancer stem cells (26)
- Stem cell relevant signaling - JAK/STAT signaling pathway (19)
- Ion Channels: Other (17)
- P450 (16)
- Ion Channels: Transient receptor potential (15)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (12)
- Ion Channels: Glutamate Receptors (9)
- Ion Channels: Potassium (9)
- Stem cell relevant signaling - DSL/Notch pathway (9)
- Stem cell relevant signaling - Wnt Signaling pathway (6)
- Ion Channels: ATP Receptors (3)
- Ion Channels: Cyclic nucleotide gated (3)
- Ion Channels: Cys-loop Receptors (3)
- Ion Channels: Calcium (1)
Pathways
- Pathways in cancer (265)
- Metabolic pathways (237)
- Neuroactive ligand-receptor interaction (135)
- MAPK signaling pathway (132)
- Cytokine-cytokine receptor interaction (113)
- Focal adhesion (112)
- Neurotrophin signaling pathway (109)
- Apoptosis (103)
- Olfactory transduction (100)
- Prostate cancer (98)
- Chemokine signaling pathway (97)
- Toll-like receptor signaling pathway (94)
- Colorectal cancer (93)
- Small cell lung cancer (91)
- Insulin signaling pathway (90)
- Cell cycle (89)
- Chronic myeloid leukemia (89)
- Regulation of actin cytoskeleton (85)
- Alzheimer's disease (76)
- Calcium signaling pathway (74)
- Pancreatic cancer (74)
- Adipocytokine signaling pathway (73)
- T cell receptor signaling pathway (73)
- Huntington's disease (72)
- Endocytosis (71)
- RIG-I-like receptor signaling pathway (71)
- NOD-like receptor signaling pathway (69)
- Progesterone-mediated oocyte maturation (69)
- Systemic lupus erythematosus (67)
- Wnt signaling pathway (67)
- p53 signaling pathway (65)
- ErbB signaling pathway (63)
- Jak-STAT signaling pathway (62)
- Acute myeloid leukemia (61)
- Glioma (58)
- Melanoma (57)
- Leukocyte transendothelial migration (56)
- Non-small cell lung cancer (56)
- Oocyte meiosis (56)
- B cell receptor signaling pathway (55)
- Endometrial cancer (53)
- Parkinson's disease (53)
- Renal cell carcinoma (53)
- mTOR signaling pathway (52)
- Ubiquitin mediated proteolysis (51)
- Natural killer cell mediated cytotoxicity (48)
- Adherens junction (46)
- Cytosolic DNA-sensing pathway (46)
- Amyotrophic lateral sclerosis (ALS) (45)
- Axon guidance (44)
- Epithelial cell signaling in Helicobacter pylori infection (43)
- VEGF signaling pathway (43)
- Melanogenesis (42)
- Fc gamma R-mediated phagocytosis (41)
- Pathogenic Escherichia coli infection (41)
- Tight junction (41)
- Gap junction (40)
- Antigen processing and presentation (39)
- Bladder cancer (37)
- Glycolysis / Gluconeogenesis (36)
- TGF-beta signaling pathway (36)
- Vascular smooth muscle contraction (36)
- Purine metabolism (35)
- Basal cell carcinoma (33)
- Hematopoietic cell lineage (33)
- ECM-receptor interaction (32)
- Fc epsilon RI signaling pathway (32)
- Regulation of autophagy (32)
- Type II diabetes mellitus (32)
- Notch signaling pathway (30)
- Viral myocarditis (29)
- Cell adhesion molecules (CAMs) (28)
- GnRH signaling pathway (27)
- Long-term potentiation (27)
- Spliceosome (27)
- Lysosome (25)
- Oxidative phosphorylation (24)
- Dilated cardiomyopathy (23)
- PPAR signaling pathway (23)
- Complement and coagulation cascades (22)
- Prion diseases (22)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (21)
- RNA degradation (21)
- Thyroid cancer (21)
- Vibrio cholerae infection (21)
- Base excision repair (20)
- Hypertrophic cardiomyopathy (HCM) (20)
- Metabolism of xenobiotics by cytochrome P450 (19)
- Primary immunodeficiency (19)
- Hedgehog signaling pathway (18)
- Phosphatidylinositol signaling system (18)
- Long-term depression (17)
- Pyrimidine metabolism (17)
- Arginine and proline metabolism (16)
- Inositol phosphate metabolism (16)
- Pyruvate metabolism (16)
- Ribosome (16)
- Type I diabetes mellitus (16)
- Citrate cycle (TCA cycle) (15)
- DNA replication (14)
- Glycerolipid metabolism (14)
- Maturity onset diabetes of the young (14)
- Non-homologous end-joining (13)
- Cardiac muscle contraction (12)
- Drug metabolism - cytochrome P450 (12)
- Glutathione metabolism (12)
- Nucleotide excision repair (12)
- Homologous recombination (11)
- Valine (11)
- Alanine (10)
- Butanoate metabolism (10)
- Cysteine and methionine metabolism (10)
- Fatty acid metabolism (10)
- Mismatch repair (10)
- Propanoate metabolism (10)
- Renin-angiotensin system (10)
- Retinol metabolism (10)
- Taste transduction (10)
- aspartate and glutamate metabolism (10)
- Arachidonic acid metabolism (9)
- Glycerophospholipid metabolism (9)
- Tyrosine metabolism (9)
- Lysine degradation (8)
- Proteasome (8)
- Allograft rejection (7)
- Dorso-ventral axis formation (7)
- Fructose and mannose metabolism (7)
- Graft-versus-host disease (7)
- Histidine metabolism (7)
- O-Glycan biosynthesis (7)
- Tryptophan metabolism (7)
- leucine and isoleucine degradation (7)
- Amino sugar and nucleotide sugar metabolism (6)
- Drug metabolism - other enzymes (6)
- Glycine (6)
- Pentose phosphate pathway (6)
- Primary bile acid biosynthesis (6)
- beta-Alanine metabolism (6)
- serine and threonine metabolism (6)
- ABC transporters (5)
- Asthma (5)
- Autoimmune thyroid disease (5)
- Basal transcription factors (5)
- Biosynthesis of unsaturated fatty acids (5)
- Folate biosynthesis (5)
- Heparan sulfate biosynthesis (5)
- Linoleic acid metabolism (5)
- N-Glycan biosynthesis (5)
- Nitrogen metabolism (5)
- Selenoamino acid metabolism (5)
- Sphingolipid metabolism (5)
- Aminoacyl-tRNA biosynthesis (4)
- Androgen and estrogen metabolism (4)
- C21-Steroid hormone metabolism (4)
- Fatty acid biosynthesis (4)
- RNA polymerase (4)
- leucine and isoleucine biosynthesis (4)
- Chondroitin sulfate biosynthesis (3)
- Circadian rhythm - mammal (3)
- D-Glutamine and D-glutamate metabolism (3)
- Galactose metabolism (3)
- Glycosaminoglycan degradation (3)
- Limonene and pinene degradation (3)
- Nicotinate and nicotinamide metabolism (3)
- Porphyrin and chlorophyll metabolism (3)
- SNARE interactions in vesicular transport (3)
- Taurine and hypotaurine metabolism (3)
- Terpenoid backbone biosynthesis (3)
- Ascorbate and aldarate metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Keratan sulfate biosynthesis (2)
- Other glycan degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Synthesis and degradation of ketone bodies (2)
- Caffeine metabolism (1)
- Ether lipid metabolism (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Methane metabolism (1)
- One carbon pool by folate (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Riboflavin metabolism (1)
- Starch and sucrose metabolism (1)
- Sulfur metabolism (1)
- Vitamin B6 metabolism (1)