Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Transmembrane
Filter by
Target Symbol
- EGFR (22)
- KDR (16)
- APP (12)
- CXCR4 (11)
- EGF (11)
- PDGFRB (11)
- TRPM8 (11)
- BAX (10)
- BCL2 (10)
- CSF1R (10)
- ERBB2 (10)
- GRIN1 (10)
- ACE2 (9)
- GJA1 (9)
- MUC1 (9)
- TLR4 (9)
- AIFM1 (8)
- CDH1 (8)
- GRIA2 (8)
- HMOX1 (8)
- PTGS1 (8)
- ADRA1B (7)
- BCL2L1 (7)
- BDNF (7)
- CLDN7 (7)
- ERBB4 (7)
- GCNT3 (7)
- GRM1 (7)
- ITGA6 (7)
- LGR5 (7)
- MUC13 (7)
- NPHS1 (7)
- NPY1R (7)
- RXFP1 (7)
- SLC39A6 (7)
- SLITRK6 (7)
- TLR3 (7)
- TNF (7)
- TNFSF13 (7)
- ADAM20 (6)
- ADGRB1 (6)
- AGER (6)
- APLNR (6)
- CASR (6)
- CD274 (6)
- CELSR3 (6)
- CLDN1 (6)
- COMT (6)
- COX4I1 (6)
- CRHR1 (6)
- CX3CR1 (6)
- ELOVL5 (6)
- ENPP3 (6)
- ERBB3 (6)
- FGFR1 (6)
- FGFR2 (6)
- FGFR3 (6)
- G6PC1 (6)
- GRIK1 (6)
- GRM7 (6)
- GRPR (6)
- HCRTR1 (6)
- HTR2C (6)
- ITGB3 (6)
- KIT (6)
- MET (6)
- MME (6)
- NRG1 (6)
- NTRK2 (6)
- RTN4 (6)
- SCARB1 (6)
- SLC1A4 (6)
- SLC29A1 (6)
- SLC5A1 (6)
- STEAP2 (6)
- STEAP4 (6)
- SYP (6)
- TLR2 (6)
- TLR8 (6)
- TM9SF1 (6)
- TNFRSF1A (6)
- TRPA1 (6)
- TRPV4 (6)
- ABCB5 (5)
- ADRA1A (5)
- ADRB2 (5)
- ATP1B3 (5)
- ATRN (5)
- BAI2 (5)
- BNIP3L (5)
- BSG (5)
- CANX (5)
- CCKAR (5)
- CCR3 (5)
- CD70 (5)
- CD8A (5)
- CDCP1 (5)
- CNR2 (5)
- CXCR2 (5)
- CXCR3 (5)
Reactivities
- Human (3300)
- Mouse (2040)
- Rat (1708)
- Monkey (240)
- Bovine (164)
- Gorilla (126)
- Dog (115)
- Rabbit (104)
- Hamster (96)
- Horse (95)
- Gibbon (94)
- Pig (87)
- Bat (85)
- Chicken (46)
- Chimpanzee (34)
- Xenopus (32)
- Orang-Utan (27)
- Guinea Pig (23)
- Primate (20)
- Zebrafish (19)
- Rhesus Monkey (18)
- Canine (7)
- Porcine (6)
- Macaque (5)
- Sheep (5)
- X. tropicalis (5)
- Cow (3)
- Drosophila (3)
- Equine (3)
- Feline (3)
- Avian (1)
- Goat (1)
- Mink (1)
- Opossum (1)
- Pufferfish (1)
- Quail (1)
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (551)
- Cytokine-cytokine receptor interaction (384)
- Pathways in cancer (286)
- Calcium signaling pathway (276)
- Metabolic pathways (269)
- Cell adhesion molecules (CAMs) (195)
- Endocytosis (176)
- Focal adhesion (150)
- Hematopoietic cell lineage (149)
- MAPK signaling pathway (147)
- Regulation of actin cytoskeleton (147)
- Alzheimer's disease (110)
- Colorectal cancer (108)
- Gap junction (107)
- Leukocyte transendothelial migration (97)
- Chemokine signaling pathway (93)
- Melanogenesis (89)
- Adherens junction (88)
- Prostate cancer (88)
- Amyotrophic lateral sclerosis (ALS) (80)
- Dilated cardiomyopathy (80)
- Toll-like receptor signaling pathway (80)
- Melanoma (78)
- Jak-STAT signaling pathway (75)
- Pancreatic cancer (72)
- Apoptosis (69)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (69)
- ErbB signaling pathway (69)
- Hypertrophic cardiomyopathy (HCM) (69)
- Vascular smooth muscle contraction (69)
- Axon guidance (67)
- Wnt signaling pathway (64)
- Basal cell carcinoma (63)
- Natural killer cell mediated cytotoxicity (61)
- Adipocytokine signaling pathway (60)
- Bladder cancer (60)
- ECM-receptor interaction (60)
- Huntington's disease (60)
- Glioma (55)
- Neurotrophin signaling pathway (55)
- ABC transporters (52)
- Long-term potentiation (52)
- Endometrial cancer (51)
- GnRH signaling pathway (49)
- Epithelial cell signaling in Helicobacter pylori infection (47)
- Hedgehog signaling pathway (47)
- Lysosome (46)
- Non-small cell lung cancer (46)
- Tight junction (45)
- Antigen processing and presentation (44)
- Long-term depression (42)
- Parkinson's disease (40)
- TGF-beta signaling pathway (40)
- Small cell lung cancer (39)
- Cardiac muscle contraction (37)
- Purine metabolism (37)
- Viral myocarditis (36)
- Drug metabolism - cytochrome P450 (35)
- Renin-angiotensin system (35)
- Pathogenic Escherichia coli infection (34)
- PPAR signaling pathway (33)
- Systemic lupus erythematosus (32)
- Allograft rejection (31)
- Graft-versus-host disease (31)
- Metabolism of xenobiotics by cytochrome P450 (31)
- Retinol metabolism (31)
- Type I diabetes mellitus (31)
- Arachidonic acid metabolism (29)
- Autoimmune thyroid disease (29)
- Oxidative phosphorylation (29)
- T cell receptor signaling pathway (28)
- Complement and coagulation cascades (27)
- Dorso-ventral axis formation (27)
- Notch signaling pathway (27)
- Olfactory transduction (27)
- Primary immunodeficiency (27)
- Chronic myeloid leukemia (26)
- Starch and sucrose metabolism (25)
- Type II diabetes mellitus (24)
- p53 signaling pathway (24)
- SNARE interactions in vesicular transport (23)
- N-Glycan biosynthesis (22)
- Renal cell carcinoma (22)
- Sphingolipid metabolism (22)
- Porphyrin and chlorophyll metabolism (21)
- Taste transduction (21)
- Tyrosine metabolism (21)
- Vibrio cholerae infection (21)
- Biosynthesis of unsaturated fatty acids (20)
- Oocyte meiosis (20)
- Progesterone-mediated oocyte maturation (20)
- RIG-I-like receptor signaling pathway (20)
- Androgen and estrogen metabolism (19)
- Asthma (19)
- O-Glycan biosynthesis (19)
- Drug metabolism - other enzymes (18)
- Fatty acid metabolism (18)
- Linoleic acid metabolism (18)
- Prion diseases (18)
- VEGF signaling pathway (17)
- B cell receptor signaling pathway (16)
- Insulin signaling pathway (16)
- Cytosolic DNA-sensing pathway (15)
- Thyroid cancer (15)
- Glycerophospholipid metabolism (14)
- Nicotinate and nicotinamide metabolism (14)
- Riboflavin metabolism (14)
- Acute myeloid leukemia (13)
- Glycerolipid metabolism (13)
- NOD-like receptor signaling pathway (13)
- Tryptophan metabolism (13)
- Glutathione metabolism (12)
- Chondroitin sulfate biosynthesis (11)
- Fc gamma R-mediated phagocytosis (11)
- Ascorbate and aldarate metabolism (10)
- Glycolysis / Gluconeogenesis (10)
- Glycosphingolipid biosynthesis - lacto and neolacto series (10)
- Heparan sulfate biosynthesis (10)
- Pentose and glucuronate interconversions (10)
- Pyrimidine metabolism (10)
- Galactose metabolism (9)
- Primary bile acid biosynthesis (9)
- Ether lipid metabolism (8)
- Fc epsilon RI signaling pathway (8)
- C21-Steroid hormone metabolism (7)
- Keratan sulfate biosynthesis (7)
- Caffeine metabolism (6)
- Cell cycle (6)
- Glycosaminoglycan degradation (6)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (6)
- Pantothenate and CoA biosynthesis (6)
- Propanoate metabolism (6)
- Steroid biosynthesis (6)
- Valine (6)
- leucine and isoleucine degradation (6)
- Arginine and proline metabolism (5)
- Glycosphingolipid biosynthesis - ganglio series (5)
- Glycosphingolipid biosynthesis - globo series (5)
- Histidine metabolism (5)
- Phosphatidylinositol signaling system (5)
- Ubiquitin mediated proteolysis (5)
- Inositol phosphate metabolism (4)
- beta-Alanine metabolism (4)
- Butanoate metabolism (3)
- Cyanoamino acid metabolism (3)
- Glycine (3)
- Limonene and pinene degradation (3)
- Lysine degradation (3)
- Nitrogen metabolism (3)
- Phenylalanine metabolism (3)
- Pyruvate metabolism (3)
- Selenoamino acid metabolism (3)
- Taurine and hypotaurine metabolism (3)
- serine and threonine metabolism (3)
- Maturity onset diabetes of the young (2)
- O-Mannosyl glycan biosynthesis (2)
- Other glycan degradation (2)
- alpha-Linolenic acid metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Base excision repair (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)