Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
USD 415.00
In Stock
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Rabbit Polyclonal PRCC Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Ku80 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-ATR antibody
| Applications | WB |
| Reactivities | Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Rabbit polyclonal LRP12 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LRP12 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 635-662 amino acids from the C-terminal region of human LRP12. |
Rabbit polyclonal SLC25A31 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SLC25A31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-167 amino acids from the Central region of human SLC25A31. |
Rabbit polyclonal NCL Antibody (Center P291)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NCL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human NCL. |
Rabbit polyclonal UCHL1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This UCHL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the C-terminal region of human UCHL1. |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
Rabbit polyclonal CYP17A1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP17A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-388 amino acids from the Central region of human CYP17A1. |
Rabbit polyclonal PIN1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PIN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-56 amino acids from the Central region of human PIN1. |
PFN1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PFN1 |
Active filters
Reactivities
- Monkey
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Category
Target Symbol
- PCNA (4)
- HSP90AB1 (3)
- TP53 (3)
- ENO1 (2)
- HSP90B1 (2)
- MELTF (2)
- NCL (2)
- RAB9A (2)
- SLC6A3 (2)
- SRD5A2 (2)
- UCHL1 (2)
- ABCB1 (1)
- ACTN1 (1)
- ACTR3 (1)
- AIP (1)
- AK1 (1)
- AKR1C1 (1)
- ALDOB (1)
- ANXA1 (1)
- APP (1)
- ATR (1)
- BSG (1)
- CASP3 (1)
- CASP7 (1)
- CCL2 (1)
- CCNA2 (1)
- CCNB1 (1)
- CD1B (1)
- CD1D (1)
- CD36 (1)
- CD38 (1)
- CD40 (1)
- CYP11B1 (1)
- CYP17A1 (1)
- CYP19A1 (1)
- CYP1B1 (1)
- CYP21A2 (1)
- ETFB (1)
- F7 (1)
- F9 (1)
- FBXW11 (1)
- FOS (1)
- GANAB (1)
- GCLM (1)
- GK2 (1)
- GLI3 (1)
- HCK (1)
- HDAC2 (1)
- HSD3B2 (1)
- HSP90AA1 (1)
- IL1R2 (1)
- IL4 (1)
- ING1 (1)
- LRP12 (1)
- MAPK3 (1)
- MSH6 (1)
- MSN (1)
- NR1H3 (1)
- ODC1 (1)
- PCK1 (1)
- PFN1 (1)
- PIN1 (1)
- PKM (1)
- PLIN2 (1)
- PPP2R2A (1)
- PRCC (1)
- PRDX2 (1)
- RAB8A (1)
- RAN (1)
- SERPINB2 (1)
- SERPINB6 (1)
- SLC25A31 (1)
- SPHK1 (1)
- STAT2 (1)
- TBP (1)
- TP53I3 (1)
- TSPYL2 (1)
- TUBB2B (1)
- TYMS (1)
- UBE2S (1)
- UQCRC1 (1)
- XRCC5 (1)
Conjugates
Modifications
Pathways
- Metabolic pathways (19)
- Pathways in cancer (15)
- Prostate cancer (12)
- Cell cycle (11)
- Huntington's disease (8)
- NOD-like receptor signaling pathway (8)
- Colorectal cancer (7)
- MAPK signaling pathway (7)
- Parkinson's disease (7)
- Progesterone-mediated oocyte maturation (7)
- p53 signaling pathway (7)
- Hematopoietic cell lineage (6)
- Alzheimer's disease (5)
- Androgen and estrogen metabolism (5)
- Apoptosis (5)
- Chronic myeloid leukemia (5)
- Glycolysis / Gluconeogenesis (5)
- Mismatch repair (5)
- Amyotrophic lateral sclerosis (ALS) (4)
- Antigen processing and presentation (4)
- Basal cell carcinoma (4)
- Base excision repair (4)
- Bladder cancer (4)
- C21-Steroid hormone metabolism (4)
- Chemokine signaling pathway (4)
- Cytokine-cytokine receptor interaction (4)
- DNA replication (4)
- Endometrial cancer (4)
- Glioma (4)
- Melanoma (4)
- Neurotrophin signaling pathway (4)
- Non-small cell lung cancer (4)
- Nucleotide excision repair (4)
- PPAR signaling pathway (4)
- Pancreatic cancer (4)
- Regulation of actin cytoskeleton (4)
- Thyroid cancer (4)
- Wnt signaling pathway (4)
- Calcium signaling pathway (3)
- Fc gamma R-mediated phagocytosis (3)
- Oocyte meiosis (3)
- Pathogenic Escherichia coli infection (3)
- Small cell lung cancer (3)
- T cell receptor signaling pathway (3)
- Toll-like receptor signaling pathway (3)
- Adherens junction (2)
- Adipocytokine signaling pathway (2)
- Allograft rejection (2)
- Asthma (2)
- Autoimmune thyroid disease (2)
- B cell receptor signaling pathway (2)
- Complement and coagulation cascades (2)
- Fc epsilon RI signaling pathway (2)
- Focal adhesion (2)
- Gap junction (2)
- Glutathione metabolism (2)
- Hedgehog signaling pathway (2)
- Insulin signaling pathway (2)
- Jak-STAT signaling pathway (2)
- Leukocyte transendothelial migration (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Natural killer cell mediated cytotoxicity (2)
- Purine metabolism (2)
- Pyruvate metabolism (2)
- RNA degradation (2)
- Systemic lupus erythematosus (2)
- Tight junction (2)
- Type II diabetes mellitus (2)
- Ubiquitin mediated proteolysis (2)
- VEGF signaling pathway (2)
- Viral myocarditis (2)
- ABC transporters (1)
- Acute myeloid leukemia (1)
- Arginine and proline metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Axon guidance (1)
- Basal transcription factors (1)
- Cardiac muscle contraction (1)
- Cell adhesion molecules (CAMs) (1)
- Citrate cycle (TCA cycle) (1)
- Dorso-ventral axis formation (1)
- ECM-receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Fructose and mannose metabolism (1)
- Glycerolipid metabolism (1)
- GnRH signaling pathway (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Melanogenesis (1)
- N-Glycan biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- Non-homologous end-joining (1)
- Notch signaling pathway (1)
- One carbon pool by folate (1)
- Oxidative phosphorylation (1)
- Pentose phosphate pathway (1)
- Primary immunodeficiency (1)
- Prion diseases (1)
- Pyrimidine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Renal cell carcinoma (1)
- Sphingolipid metabolism (1)
- TGF-beta signaling pathway (1)
- Tryptophan metabolism (1)
- Vascular smooth muscle contraction (1)
- mTOR signaling pathway (1)