Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
Download
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CADH6 antibody for SISCAPA, clone OTIR5A6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SLC6A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC6A2 antibody: synthetic peptide directed towards the middle region of human SLC6A2. Synthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit anti-ABHD6 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABHD6. |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Families
- Transmembrane
Filter by
Target Symbol
- EGFR (32)
- KDR (18)
- ERBB2 (16)
- APP (15)
- IGF1R (15)
- BCL2L1 (14)
- BAX (12)
- CSF1R (12)
- FGFR1 (12)
- MET (12)
- GRIN1 (11)
- BCL2 (10)
- GJA1 (10)
- GRIN2B (10)
- NGFR (10)
- NTRK2 (10)
- EPOR (9)
- GRIA2 (9)
- ITGB3 (9)
- AIFM1 (8)
- CANX (8)
- CLDN1 (8)
- CLDN7 (8)
- EPHA2 (8)
- KIT (8)
- PDGFRB (8)
- TGFB2 (8)
- TGFBR1 (8)
- TGFBR2 (8)
- CLDN5 (7)
- CXCR4 (7)
- CYP1A1 (7)
- GRM1 (7)
- GRM3 (7)
- HMOX1 (7)
- PECAM1 (7)
- SOX1 (7)
- SYT1 (7)
- TLR4 (7)
- TNFSF11 (7)
- TRPC3 (7)
- ACVR1 (6)
- ADRA1B (6)
- BDNF (6)
- CASR (6)
- CD247 (6)
- CD44 (6)
- CDH5 (6)
- CHRM1 (6)
- CLDN4 (6)
- EFNB2 (6)
- EPHA3 (6)
- ERBB4 (6)
- FGF4 (6)
- GRIA1 (6)
- MCL1 (6)
- MME (6)
- MSR1 (6)
- MUC1 (6)
- NOTCH2 (6)
- P2RY2 (6)
- SCARB1 (6)
- SSTR1 (6)
- TLR3 (6)
- TLR7 (6)
- TNFRSF1B (6)
- TNFSF13 (6)
- TRPV1 (6)
- ACE2 (5)
- ADAM15 (5)
- ADAM17 (5)
- ANTXR1 (5)
- AQP1 (5)
- AQP2 (5)
- ATP1A1 (5)
- ATP7B (5)
- BAK1 (5)
- BCL2L2 (5)
- BMPR2 (5)
- CAV1 (5)
- CDH1 (5)
- CFTR (5)
- CLDN10 (5)
- CLDN11 (5)
- CLDN3 (5)
- CRHR2 (5)
- CUX1 (5)
- CXCR3 (5)
- DDR1 (5)
- DIABLO (5)
- EDA (5)
- EIF2AK3 (5)
- EPHA4 (5)
- EPHA7 (5)
- FGFR2 (5)
- FGFR3 (5)
- FKRP (5)
- GABBR1 (5)
- GLRA1 (5)
- GRIA3 (5)
Applications
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (452)
- Cytokine-cytokine receptor interaction (384)
- Pathways in cancer (326)
- Calcium signaling pathway (245)
- Endocytosis (196)
- Metabolic pathways (189)
- Cell adhesion molecules (CAMs) (181)
- Focal adhesion (174)
- MAPK signaling pathway (160)
- Colorectal cancer (155)
- Regulation of actin cytoskeleton (146)
- Adherens junction (134)
- Hematopoietic cell lineage (132)
- Alzheimer's disease (120)
- Prostate cancer (109)
- Leukocyte transendothelial migration (105)
- Gap junction (102)
- Melanoma (102)
- Pancreatic cancer (102)
- Amyotrophic lateral sclerosis (ALS) (96)
- Axon guidance (94)
- Jak-STAT signaling pathway (87)
- Dilated cardiomyopathy (86)
- Melanogenesis (86)
- Hypertrophic cardiomyopathy (HCM) (73)
- ErbB signaling pathway (71)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (70)
- Apoptosis (69)
- Glioma (66)
- Epithelial cell signaling in Helicobacter pylori infection (65)
- Huntington's disease (65)
- Wnt signaling pathway (65)
- Long-term potentiation (63)
- ECM-receptor interaction (62)
- TGF-beta signaling pathway (62)
- Basal cell carcinoma (61)
- Bladder cancer (61)
- Neurotrophin signaling pathway (61)
- ABC transporters (60)
- Chemokine signaling pathway (57)
- GnRH signaling pathway (57)
- Tight junction (57)
- Endometrial cancer (56)
- Non-small cell lung cancer (54)
- Toll-like receptor signaling pathway (54)
- Long-term depression (52)
- Vascular smooth muscle contraction (50)
- Chronic myeloid leukemia (48)
- Natural killer cell mediated cytotoxicity (47)
- Small cell lung cancer (41)
- Adipocytokine signaling pathway (40)
- Hedgehog signaling pathway (40)
- Dorso-ventral axis formation (38)
- Lysosome (33)
- Notch signaling pathway (32)
- Renal cell carcinoma (32)
- Parkinson's disease (31)
- Systemic lupus erythematosus (31)
- Cardiac muscle contraction (30)
- Retinol metabolism (30)
- Oocyte meiosis (29)
- Pathogenic Escherichia coli infection (29)
- Progesterone-mediated oocyte maturation (29)
- Primary immunodeficiency (28)
- Renin-angiotensin system (28)
- p53 signaling pathway (28)
- Oxidative phosphorylation (27)
- Purine metabolism (27)
- Viral myocarditis (27)
- PPAR signaling pathway (23)
- SNARE interactions in vesicular transport (23)
- T cell receptor signaling pathway (23)
- Vibrio cholerae infection (23)
- Metabolism of xenobiotics by cytochrome P450 (22)
- Antigen processing and presentation (21)
- Glycerolipid metabolism (20)
- Prion diseases (19)
- VEGF signaling pathway (19)
- Arachidonic acid metabolism (18)
- Drug metabolism - cytochrome P450 (18)
- N-Glycan biosynthesis (18)
- Porphyrin and chlorophyll metabolism (18)
- Type II diabetes mellitus (18)
- Glycerophospholipid metabolism (17)
- Allograft rejection (16)
- Complement and coagulation cascades (16)
- Autoimmune thyroid disease (15)
- Graft-versus-host disease (15)
- Taste transduction (15)
- Tryptophan metabolism (15)
- Tyrosine metabolism (15)
- Acute myeloid leukemia (14)
- Thyroid cancer (14)
- Asthma (13)
- B cell receptor signaling pathway (13)
- Ether lipid metabolism (13)
- Type I diabetes mellitus (13)
- Insulin signaling pathway (12)
- Sphingolipid metabolism (12)
- Fatty acid metabolism (11)
- Fc gamma R-mediated phagocytosis (11)
- Pyrimidine metabolism (11)
- Androgen and estrogen metabolism (10)
- Cell cycle (10)
- Drug metabolism - other enzymes (10)
- Glutathione metabolism (10)
- Glycosphingolipid biosynthesis - lacto and neolacto series (10)
- Heparan sulfate biosynthesis (10)
- Riboflavin metabolism (10)
- Linoleic acid metabolism (9)
- Nicotinate and nicotinamide metabolism (9)
- RIG-I-like receptor signaling pathway (9)
- Starch and sucrose metabolism (9)
- Chondroitin sulfate biosynthesis (8)
- Cytosolic DNA-sensing pathway (7)
- Fc epsilon RI signaling pathway (7)
- O-Glycan biosynthesis (7)
- Ascorbate and aldarate metabolism (6)
- Biosynthesis of unsaturated fatty acids (6)
- Olfactory transduction (6)
- Pentose and glucuronate interconversions (6)
- NOD-like receptor signaling pathway (5)
- Nitrogen metabolism (5)
- Primary bile acid biosynthesis (5)
- Cyanoamino acid metabolism (4)
- Glycosphingolipid biosynthesis - ganglio series (4)
- Keratan sulfate biosynthesis (4)
- Phosphatidylinositol signaling system (4)
- Selenoamino acid metabolism (4)
- Steroid biosynthesis (4)
- Taurine and hypotaurine metabolism (4)
- Ubiquitin mediated proteolysis (4)
- Arginine and proline metabolism (3)
- Caffeine metabolism (3)
- Glycine (3)
- Histidine metabolism (3)
- Inositol phosphate metabolism (3)
- Phenylalanine metabolism (3)
- Propanoate metabolism (3)
- Valine (3)
- leucine and isoleucine degradation (3)
- serine and threonine metabolism (3)
- C21-Steroid hormone metabolism (2)
- Galactose metabolism (2)
- Glycolysis / Gluconeogenesis (2)
- Glycosaminoglycan degradation (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Pantothenate and CoA biosynthesis (2)
- Terpenoid backbone biosynthesis (2)
- beta-Alanine metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Base excision repair (1)
- Butanoate metabolism (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Limonene and pinene degradation (1)
- Lysine degradation (1)
- Maturity onset diabetes of the young (1)
- O-Mannosyl glycan biosynthesis (1)
- Pyruvate metabolism (1)
- Sulfur metabolism (1)
- alpha-Linolenic acid metabolism (1)