Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit polyclonal anti-POLR2C antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C. |
Rabbit Polyclonal Anti-POLR1E Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR1E antibody: synthetic peptide directed towards the N terminal of human POLR1E. Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL |
Rabbit Polyclonal Anti-NME7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NME7 |
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BACE1 |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit polyclonal anti-PDE3B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Rabbit polyclonal POLR2A (Ab-1619) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
Rabbit anti-PDE4D Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDE4D |
Rabbit anti-POLR2C Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human POLR2C |
Rabbit Polyclonal Anti-ADK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADK |
Rabbit polyclonal ITPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-51 amino acids from the N-terminal region of human ITPA. |
FHIT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FHIT |
POLR2I Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human POLR2I |
Rabbit anti-APRT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human APRT |
Rabbit anti-HPRT1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HPRT1 |
Rabbit anti-PNP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PNP |
Rabbit Polyclonal Anti-POLR2C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Polr2c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Polr2c. Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR |
Rabbit Polyclonal Anti-PDE4D Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE4D antibody is: synthetic peptide directed towards the C-terminal region of Human PDE4D. Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ |
Rabbit Polyclonal Anti-PDE4D Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pde4d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ |
Rabbit Polyclonal Anti-HPRT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
Rabbit Polyclonal Anti-NM23 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NM23 Antibody: A synthesized peptide derived from human NM23 |
Rabbit Polyclonal Anti-NT5C3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3 |
Rabbit Polyclonal Anti-GCYB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCYB1 Antibody: A synthesized peptide derived from human GCYB1 |
Rabbit polyclonal antibody to POLR3A (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 482 of POLR3A (Uniprot ID#O14802) |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Active filters
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Pathways
- Purine metabolism
Filter by
Category
Target Symbol
- PKM (6)
- AK1 (5)
- FHIT (5)
- AK4 (4)
- NME2 (4)
- PDE9A (4)
- ADA (3)
- ADCY1 (3)
- ADCY4 (3)
- ADCY5 (3)
- DCK (3)
- NT5E (3)
- PDE4D (3)
- PNPT1 (3)
- POLR2C (3)
- POLR2G (3)
- RRM1 (3)
- ADK (2)
- AK2 (2)
- AK5 (2)
- AMPD1 (2)
- ATIC (2)
- ENPP3 (2)
- ENTPD5 (2)
- GUCY1B1 (2)
- HPRT1 (2)
- IMPDH2 (2)
- ITPA (2)
- NME3 (2)
- NME5 (2)
- NPR1 (2)
- NT5C1A (2)
- PDE1B (2)
- POLD1 (2)
- POLR2A (2)
- POLR2D (2)
- POLR2I (2)
- PRPS1 (2)
- RRM2B (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- ADSL (1)
- AMPD2 (1)
- APRT (1)
- ENTPD1 (1)
- ENTPD3 (1)
- ENTPD6 (1)
- GUCY1A1 (1)
- GUK1 (1)
- IMPDH1 (1)
- NME6 (1)
- NME7 (1)
- NPR2 (1)
- NT5C2 (1)
- NT5C3A (1)
- PAICS (1)
- PAPSS1 (1)
- PDE1A (1)
- PDE1C (1)
- PDE3B (1)
- PDE4C (1)
- PDE5A (1)
- PDE6D (1)
- PNP (1)
- POLD2 (1)
- POLD3 (1)
- POLE (1)
- POLE3 (1)
- POLE4 (1)
- POLR1B (1)
- POLR1C (1)
- POLR1E (1)
- POLR2E (1)
- POLR2H (1)
- POLR2J (1)
- POLR3A (1)
- POLR3B (1)
- POLR3D (1)
- POLR3F (1)
- POLR3H (1)
- PPAT (1)
- PRIM1 (1)
- PRPS2 (1)
- RRM2 (1)