Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 515.00
In Stock
USD 380.00
2 Weeks
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
SKP1 (C-term) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 152-163 of Human SKP1 (C-terminus) coupled to KLH. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-MED17 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal anti-HDAC6 antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC6 antibody: synthetic peptide directed towards the N terminal of human HDAC6. Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
Active filters
Filter by
Target Symbol
- MS4A1 (9)
- BTN3A2 (5)
- CXCR4 (5)
- SERPINB3 (5)
- TP53 (5)
- CTNNB1 (2)
- EGFR (2)
- ESR1 (2)
- HDAC2 (2)
- MED6 (2)
- ABCD3 (1)
- AGL (1)
- ALOX5AP (1)
- BST2 (1)
- CCND1 (1)
- CD5 (1)
- CYP26C1 (1)
- EHMT2 (1)
- EZH1 (1)
- EZH2 (1)
- FBXO11 (1)
- H2AFZ (1)
- HDAC1 (1)
- HDAC4 (1)
- HDAC6 (1)
- IL11RA (1)
- IL13RA1 (1)
- ITGAV (1)
- JUN (1)
- KLKB1 (1)
- MBD4 (1)
- MED17 (1)
- MED19 (1)
- MYC (1)
- NR3C1 (1)
- PAX8 (1)
- PRKCG (1)
- RETN (1)
- SKP1 (1)
- SRF (1)
- STC1 (1)
- TBP (1)
- TGFB1 (1)
- THRB (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Pathways
- Pathways in cancer (19)
- Colorectal cancer (13)
- Cell cycle (12)
- MAPK signaling pathway (12)
- Wnt signaling pathway (12)
- Chronic myeloid leukemia (11)
- Endometrial cancer (11)
- Hematopoietic cell lineage (11)
- Cytokine-cytokine receptor interaction (10)
- Prostate cancer (10)
- Thyroid cancer (10)
- Bladder cancer (9)
- Glioma (9)
- Huntington's disease (9)
- Non-small cell lung cancer (9)
- Pancreatic cancer (9)
- Focal adhesion (8)
- Leukocyte transendothelial migration (8)
- Melanoma (8)
- Small cell lung cancer (8)
- Basal cell carcinoma (7)
- Endocytosis (7)
- Neurotrophin signaling pathway (6)
- p53 signaling pathway (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Apoptosis (5)
- Axon guidance (5)
- Chemokine signaling pathway (5)
- ErbB signaling pathway (5)
- Adherens junction (4)
- Jak-STAT signaling pathway (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Calcium signaling pathway (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Gap junction (3)
- GnRH signaling pathway (3)
- Melanogenesis (3)
- Notch signaling pathway (3)
- Regulation of actin cytoskeleton (3)
- TGF-beta signaling pathway (3)
- Tight junction (3)
- Acute myeloid leukemia (2)
- Dilated cardiomyopathy (2)
- Dorso-ventral axis formation (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Neuroactive ligand-receptor interaction (2)
- Pathogenic Escherichia coli infection (2)
- Renal cell carcinoma (2)
- ABC transporters (1)
- B cell receptor signaling pathway (1)
- Basal transcription factors (1)
- Base excision repair (1)
- Cell adhesion molecules (CAMs) (1)
- Complement and coagulation cascades (1)
- ECM-receptor interaction (1)
- Fc gamma R-mediated phagocytosis (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Metabolic pathways (1)
- Natural killer cell mediated cytotoxicity (1)
- Oocyte meiosis (1)
- Phosphatidylinositol signaling system (1)
- Retinol metabolism (1)
- Starch and sucrose metabolism (1)
- Systemic lupus erythematosus (1)
- T cell receptor signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)