Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
BLK Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This BLK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BLK. |
Rabbit Polyclonal Anti-BRD4 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal ZIPK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ZIP kinase antibody was raised against a peptide corresponding to amino acids near the center of human ZIP kinase. The immunogen is located within amino acids 270 - 320 of ZIPK. |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85) |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TRIM33 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33. Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK |
Rabbit polyclonal ETK / BMX(Ab-566) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ETK around the phosphorylation site of tyrosine 566 (D-Q-YP-V-S). |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal FGFR4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4. |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal TNK2 / ACK1 (Tyr284) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ACK1 around the phosphorylation site of tyrosine 284 (D-H-YP-V-M). |
| Modifications | Phospho-specific |
Active filters
Filter by
Target Symbol
- MAP2K1 (202)
- MAP2K3 (131)
- MAPK13 (88)
- ERBB2 (84)
- BUB1B (55)
- MAPK7 (55)
- AKT1 (53)
- CDK2 (52)
- BTK (51)
- LIMK1 (51)
- PRKCE (40)
- PRKY (35)
- BRAF (33)
- PDGFRB (31)
- PRKD2 (31)
- TRIM28 (31)
- PIM2 (30)
- RPS6KB1 (28)
- MAP2K4 (27)
- FGFR2 (25)
- EGFR (24)
- FRK (21)
- TYRO3 (21)
- DAPK2 (20)
- PTK2 (20)
- RET (18)
- CHEK2 (17)
- MAP2K2 (17)
- MAPK1 (17)
- MAPK8 (17)
- STK39 (16)
- MAPK9 (15)
- NEK6 (15)
- PASK (15)
- PKMYT1 (15)
- ROS1 (15)
- MET (14)
- TRIM33 (12)
- AKT2 (11)
- MAPK4 (11)
- NEK9 (11)
- NTRK3 (11)
- PTK7 (11)
- AKT3 (10)
- NEK11 (10)
- PRKG1 (10)
- MAPK3 (9)
- CAMK1D (8)
- NTRK2 (8)
- ALK (7)
- KDR (7)
- BCKDK (6)
- CDK5 (6)
- FGFR3 (6)
- HSPB8 (6)
- MAPK6 (6)
- PAK1 (6)
- PLK1 (6)
- SCYL3 (6)
- SGK1 (6)
- AURKC (5)
- BMX (5)
- CDK6 (5)
- ERBB3 (5)
- IKBKB (5)
- IRAK2 (5)
- LIMK2 (5)
- MAPK11 (5)
- NRBP1 (5)
- NTRK1 (5)
- PHKG2 (5)
- PRKDC (5)
- RIOK2 (5)
- RPS6KA1 (5)
- STK38L (5)
- TRIB2 (5)
- UHMK1 (5)
- ABL1 (4)
- AURKA (4)
- CHUK (4)
- CSF1R (4)
- CSNK1A1 (4)
- EPHA2 (4)
- FLT3 (4)
- MAP3K5 (4)
- MAPK14 (4)
- MTOR (4)
- PRKAA1 (4)
- PRKCQ (4)
- AURKB (3)
- DYRK1A (3)
- ERN1 (3)
- FLT1 (3)
- GSK3B (3)
- IRAK1 (3)
- LCK (3)
- MAPK15 (3)
- PDGFRA (3)
- PDK4 (3)
- PIM1 (3)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- MAPK signaling pathway (850)
- Pathways in cancer (739)
- Fc epsilon RI signaling pathway (706)
- GnRH signaling pathway (629)
- Toll-like receptor signaling pathway (624)
- Neurotrophin signaling pathway (610)
- ErbB signaling pathway (607)
- Prostate cancer (594)
- Focal adhesion (581)
- Progesterone-mediated oocyte maturation (555)
- Pancreatic cancer (498)
- T cell receptor signaling pathway (476)
- Non-small cell lung cancer (474)
- Endometrial cancer (467)
- Regulation of actin cytoskeleton (463)
- Colorectal cancer (450)
- VEGF signaling pathway (450)
- Insulin signaling pathway (444)
- Fc gamma R-mediated phagocytosis (438)
- Melanoma (437)
- Acute myeloid leukemia (435)
- Glioma (432)
- Bladder cancer (420)
- Chemokine signaling pathway (395)
- B cell receptor signaling pathway (385)
- Gap junction (381)
- Chronic myeloid leukemia (379)
- Renal cell carcinoma (379)
- Vascular smooth muscle contraction (344)
- Oocyte meiosis (327)
- Thyroid cancer (301)
- Natural killer cell mediated cytotoxicity (299)
- Long-term potentiation (297)
- Long-term depression (295)
- Melanogenesis (261)
- Dorso-ventral axis formation (252)
- Prion diseases (249)
- Amyotrophic lateral sclerosis (ALS) (232)
- Epithelial cell signaling in Helicobacter pylori infection (216)
- mTOR signaling pathway (185)
- Cell cycle (174)
- NOD-like receptor signaling pathway (168)
- Calcium signaling pathway (166)
- Adherens junction (162)
- Small cell lung cancer (162)
- Axon guidance (158)
- RIG-I-like receptor signaling pathway (142)
- Adipocytokine signaling pathway (132)
- Endocytosis (130)
- Tight junction (130)
- Leukocyte transendothelial migration (124)
- Type II diabetes mellitus (109)
- Apoptosis (107)
- Cytokine-cytokine receptor interaction (97)
- Jak-STAT signaling pathway (83)
- p53 signaling pathway (83)
- TGF-beta signaling pathway (62)
- Primary immunodeficiency (58)
- Wnt signaling pathway (56)
- Alzheimer's disease (39)
- Olfactory transduction (17)
- Hedgehog signaling pathway (15)
- Regulation of autophagy (13)
- Cytosolic DNA-sensing pathway (12)
- Hematopoietic cell lineage (10)
- Pathogenic Escherichia coli infection (10)
- Hypertrophic cardiomyopathy (HCM) (5)
- Non-homologous end-joining (5)
- Vibrio cholerae infection (5)
- Viral myocarditis (5)
- Basal cell carcinoma (3)
- Dilated cardiomyopathy (3)
- Parkinson's disease (3)
- Taste transduction (3)
- Circadian rhythm - mammal (2)
- Nucleotide excision repair (2)
- Phosphatidylinositol signaling system (2)
- PPAR signaling pathway (1)
- Ubiquitin mediated proteolysis (1)