Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit polyclonal HtrA1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HtrA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-147 amino acids from the N-terminal region of human HtrA1. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Mouse Monoclonal UCHL1 / PGP9.5 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP. |
Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8) |
Rabbit polyclonal PCSK2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PCSK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 87-116 amino acids from the N-terminal region of human PCSK2. |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a 19 amino acid peptide near the carboxy terminus of human FLIP. The immunogen is located within amino acids 180 - 230 of FLIP. |
Rabbit anti-HTRA2 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTRA2 |
Rabbit polyclonal DPP3 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DPP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 583-612 amino acids from the C-terminal region of human DPP3. |
Rabbit polyclonal CPB1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CPB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 9-37 amino acids from the N-terminal region of human CPB1. |
Rabbit polyclonal UCHL1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This UCHL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the C-terminal region of human UCHL1. |
Rabbit polyclonal CASP9 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Rabbit Polyclonal Antibody against PGP9.5 - Peripheral Nerve Fiber marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human UCHL1 protein sequence (between residues 100-200). UniProt P09936 |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human FLIP. The sequence is identical in all FLIP splice variants. The immunogen is located within the first 50 amino acids of FLIP. |
Active filters
Reactivities
- Human
Applications
- IF
Families
- Protease
Filter by
Category
Target Symbol
- SENP2 (56)
- SPG7 (50)
- MMP13 (38)
- CPA1 (35)
- MGLL (30)
- ENPEP (25)
- SIL1 (25)
- HP (23)
- CLPP (20)
- CPA2 (20)
- DPP9 (20)
- LTA4H (20)
- NAPSA (20)
- TMPRSS5 (20)
- OTUB1 (16)
- XPNPEP3 (16)
- MIPEP (15)
- FOLH1 (13)
- UCHL1 (11)
- CAPN9 (10)
- GZMB (10)
- OTUB2 (10)
- PSMA1 (10)
- PSMB7 (10)
- TFR2 (10)
- USP36 (10)
- XPNPEP1 (10)
- C1S (7)
- USP10 (6)
- ADAMTS8 (5)
- BMP1 (5)
- CNDP1 (5)
- CNDP2 (5)
- COPS5 (5)
- DPP4 (5)
- METAP2 (5)
- NLN (5)
- OSGEP (5)
- PCSK7 (5)
- PEPD (5)
- PSMA7 (5)
- PSMB4 (5)
- PSMB9 (5)
- RNPEP (5)
- UQCRC1 (5)
- USP5 (5)
- USP54 (5)
- CASP9 (4)
- CASP6 (3)
- CFLAR (3)
- HTRA2 (3)
- ATG4A (2)
- ATG4B (2)
- ATG4C (2)
- BRCC3 (2)
- CAPN5 (2)
- CASP3 (2)
- CASP4 (2)
- CASP8 (2)
- CTSD (2)
- DPP3 (2)
- EPHX1 (2)
- PARK7 (2)
- PSMA6 (2)
- TMPRSS3 (2)
- USP15 (2)
- USP25 (2)
- ACY1 (1)
- ADAM10 (1)
- ADAM17 (1)
- BACE1 (1)
- C2 (1)
- CAPN6 (1)
- CASP1 (1)
- CASP10 (1)
- CASP2 (1)
- CASP5 (1)
- CPB1 (1)
- CRBN (1)
- CTSB (1)
- CTSV (1)
- DPP8 (1)
- ERAP1 (1)
- ERAP2 (1)
- ESPL1 (1)
- F10 (1)
- FREM1 (1)
- GNL3L (1)
- GZMH (1)
- GZMK (1)
- HTRA1 (1)
- LNPEP (1)
- LTF (1)
- MALT1 (1)
- MBTPS2 (1)
- MME (1)
- MMP1 (1)
- MMP10 (1)
- MMP2 (1)
- MMP9 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Metabolic pathways (61)
- Wnt signaling pathway (57)
- Proteasome (39)
- Renin-angiotensin system (32)
- Glycerolipid metabolism (30)
- Parkinson's disease (27)
- Lysosome (25)
- Arachidonic acid metabolism (20)
- Alzheimer's disease (18)
- Apoptosis (15)
- Huntington's disease (13)
- Natural killer cell mediated cytotoxicity (12)
- Pathways in cancer (11)
- Allograft rejection (10)
- Autoimmune thyroid disease (10)
- Graft-versus-host disease (10)
- Type I diabetes mellitus (10)
- Complement and coagulation cascades (9)
- Systemic lupus erythematosus (8)
- Viral myocarditis (8)
- p53 signaling pathway (8)
- Amyotrophic lateral sclerosis (ALS) (7)
- Colorectal cancer (6)
- Regulation of autophagy (6)
- Cardiac muscle contraction (5)
- Histidine metabolism (5)
- Oxidative phosphorylation (5)
- beta-Alanine metabolism (5)
- Endometrial cancer (4)
- Epithelial cell signaling in Helicobacter pylori infection (4)
- NOD-like receptor signaling pathway (4)
- Non-small cell lung cancer (4)
- Pancreatic cancer (4)
- Prostate cancer (4)
- RIG-I-like receptor signaling pathway (4)
- Small cell lung cancer (4)
- VEGF signaling pathway (4)
- Bladder cancer (3)
- Leukocyte transendothelial migration (2)
- MAPK signaling pathway (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Notch signaling pathway (2)
- Toll-like receptor signaling pathway (2)
- Antigen processing and presentation (1)
- Arginine and proline metabolism (1)
- B cell receptor signaling pathway (1)
- Cell cycle (1)
- Cytosolic DNA-sensing pathway (1)
- GnRH signaling pathway (1)
- Hematopoietic cell lineage (1)
- Neurotrophin signaling pathway (1)
- Oocyte meiosis (1)
- PPAR signaling pathway (1)
- T cell receptor signaling pathway (1)