Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human LSD1 (Lysine-specific demethylase 1), using a KLH-conjugated synthetic peptide from the inner part of the protein. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit Polyclonal ASH2 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: mouse Ash2 (absent, small, or homeotic 2), using 3 different KLH-conjugated synthetic peptides, 2 containing an amino acid sequence from the central and 1 containing an amino acid sequence from the C-terminal part of |
Active filters
Applications
- IF
Families
- Transcription Factors
Filter by
Target Symbol
- MAP2K3 (131)
- TP53 (104)
- MDM4 (75)
- CTNNB1 (61)
- PSMC3 (56)
- SQSTM1 (56)
- CD80 (47)
- ERG (47)
- ELK3 (45)
- FOXI1 (45)
- TAL1 (45)
- HDAC6 (40)
- RFXANK (40)
- TLE1 (38)
- GATA3 (37)
- PPARA (37)
- NKX2-1 (36)
- STAT5A (36)
- ID3 (35)
- LHX1 (35)
- PPP5C (35)
- SIRT5 (35)
- SSX1 (35)
- HDAC1 (34)
- MYC (33)
- PGR (32)
- SATB1 (32)
- STAT4 (31)
- TRIM28 (31)
- IRF3 (30)
- MEF2C (30)
- NEUROG1 (30)
- SSB (30)
- ZSCAN18 (28)
- ARNT (27)
- SOX17 (27)
- PBX1 (26)
- GAS7 (25)
- HHEX (25)
- IRF6 (23)
- PHF7 (20)
- SLA2 (20)
- TULP3 (20)
- HES1 (18)
- KEAP1 (17)
- SNAI2 (17)
- ARNTL (16)
- TP73 (16)
- GTF2F1 (15)
- HCFC2 (15)
- HDAC10 (15)
- PHF21B (15)
- POLR2E (15)
- SEC14L2 (15)
- SMAD2 (15)
- APEX1 (13)
- CDX2 (13)
- JUN (13)
- EGR2 (12)
- FOXP1 (12)
- GATA4 (12)
- NONO (12)
- STAT1 (12)
- TRIM33 (12)
- TSC22D3 (12)
- RYBP (11)
- TNF (11)
- WWTR1 (11)
- ASCC2 (10)
- EIF4E2 (10)
- ESRRG (10)
- ID2 (10)
- KDM4C (10)
- POGK (10)
- POU5F1 (10)
- RUVBL2 (10)
- SSX2 (10)
- ZIM2 (10)
- ZNRD1 (10)
- ZSCAN21 (10)
- TGFB1 (9)
- FOXA2 (8)
- FOXO1 (8)
- FOXO3 (8)
- CHAF1B (7)
- EWSR1 (7)
- FOXO4 (7)
- KDM1A (7)
- PDX1 (7)
- TMX1 (7)
- XRCC6 (7)
- FOXA1 (6)
- GATA6 (6)
- GLI1 (6)
- HAND1 (6)
- LEF1 (6)
- PARP1 (6)
- SIRT6 (6)
- STAT3 (6)
- TARDBP (6)
Reactivities
- Human (2789)
- Mouse (2030)
- Rat (1811)
- Dog (353)
- Monkey (350)
- Bovine (55)
- Chicken (24)
- Pig (17)
- Xenopus (16)
- Rhesus Monkey (12)
- Zebrafish (11)
- Hamster (10)
- Primate (7)
- Chimpanzee (6)
- Rabbit (6)
- X. tropicalis (6)
- Canine (5)
- Drosophila (5)
- Porcine (4)
- Sheep (3)
- Fish (2)
- Guinea Pig (2)
- Cow (1)
- Feline (1)
- Goat (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (454)
- MAPK signaling pathway (396)
- Wnt signaling pathway (277)
- Toll-like receptor signaling pathway (268)
- Chronic myeloid leukemia (264)
- Amyotrophic lateral sclerosis (ALS) (249)
- Colorectal cancer (248)
- Cell cycle (240)
- Prostate cancer (221)
- Endometrial cancer (214)
- Thyroid cancer (208)
- p53 signaling pathway (203)
- Huntington's disease (184)
- Basal cell carcinoma (178)
- Pancreatic cancer (175)
- Neurotrophin signaling pathway (167)
- Small cell lung cancer (167)
- Bladder cancer (148)
- GnRH signaling pathway (146)
- Apoptosis (143)
- Fc epsilon RI signaling pathway (142)
- TGF-beta signaling pathway (132)
- Jak-STAT signaling pathway (126)
- Non-small cell lung cancer (121)
- Melanoma (117)
- Glioma (114)
- Acute myeloid leukemia (113)
- Adherens junction (108)
- ErbB signaling pathway (92)
- Systemic lupus erythematosus (89)
- Adipocytokine signaling pathway (83)
- Melanogenesis (78)
- Focal adhesion (76)
- Maturity onset diabetes of the young (71)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (68)
- Tight junction (66)
- Notch signaling pathway (65)
- Pathogenic Escherichia coli infection (65)
- Leukocyte transendothelial migration (63)
- RIG-I-like receptor signaling pathway (62)
- Allograft rejection (59)
- Graft-versus-host disease (59)
- Renal cell carcinoma (59)
- Type I diabetes mellitus (59)
- Cytosolic DNA-sensing pathway (56)
- Proteasome (56)
- T cell receptor signaling pathway (56)
- Viral myocarditis (54)
- Antigen processing and presentation (51)
- Autoimmune thyroid disease (48)
- Cell adhesion molecules (CAMs) (48)
- Metabolic pathways (48)
- Chemokine signaling pathway (47)
- Primary immunodeficiency (45)
- PPAR signaling pathway (41)
- Oocyte meiosis (40)
- B cell receptor signaling pathway (39)
- Purine metabolism (39)
- Pyrimidine metabolism (39)
- RNA polymerase (38)
- Insulin signaling pathway (36)
- Ubiquitin mediated proteolysis (34)
- Progesterone-mediated oocyte maturation (32)
- Epithelial cell signaling in Helicobacter pylori infection (30)
- NOD-like receptor signaling pathway (29)
- Basal transcription factors (23)
- Type II diabetes mellitus (23)
- Base excision repair (21)
- Cytokine-cytokine receptor interaction (21)
- Dilated cardiomyopathy (20)
- Hypertrophic cardiomyopathy (HCM) (20)
- Circadian rhythm - mammal (19)
- Natural killer cell mediated cytotoxicity (17)
- Alzheimer's disease (16)
- mTOR signaling pathway (13)
- Asthma (11)
- Hematopoietic cell lineage (11)
- Axon guidance (10)
- Nucleotide excision repair (10)
- Dorso-ventral axis formation (8)
- Endocytosis (8)
- Neuroactive ligand-receptor interaction (8)
- Non-homologous end-joining (7)
- Hedgehog signaling pathway (6)
- RNA degradation (6)
- VEGF signaling pathway (6)
- DNA replication (5)
- Glycolysis / Gluconeogenesis (4)
- Vascular smooth muscle contraction (4)
- Calcium signaling pathway (3)
- Long-term potentiation (3)
- Cysteine and methionine metabolism (2)
- Fc gamma R-mediated phagocytosis (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Homologous recombination (1)
- Long-term depression (1)
- Prion diseases (1)
- Regulation of actin cytoskeleton (1)
- SNARE interactions in vesicular transport (1)
- Spliceosome (1)
- serine and threonine metabolism (1)