Germany
Japan
United Kingdom
China
Antibodies
Download
Goat Polyclonal Anti-UIS4 Antibody
| Applications | IF |
| Reactivities | Plasmodium berghei |
| Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Thermolysin rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bacillus sp. |
| Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Active filters
Applications
- IF
Isotypes
- IgG
Filter by
Target Symbol
- H3C1 (31)
- C3 (20)
- ALB (19)
- HISTONE H3 (18)
- AKT1 (15)
- STAT3 (14)
- GAPDH (13)
- RELA (12)
- BAX (11)
- SQSTM1 (11)
- LDHA (10)
- CASP3 (9)
- EGFR (9)
- IRS1 (9)
- LTF (9)
- MAP1LC3B (9)
- MAPT (9)
- MDH1 (9)
- RB1 (9)
- TP53 (9)
- APP (8)
- BCL2 (8)
- GJA1 (8)
- HIST1H3A (8)
- IRF3 (8)
- KDM1A (8)
- LYZ (8)
- SMAD2 (8)
- TARDBP (8)
- ATG5 (7)
- ATG7 (7)
- CCNB1 (7)
- EIF4E (7)
- ENO2 (7)
- FOXO1 (7)
- FOXO4 (7)
- HISTONE H4 (7)
- JUN (7)
- RPS6KA1 (7)
- TFAM (7)
- ALDOA (6)
- CA1 (6)
- CANX (6)
- CASP9 (6)
- CBX5 (6)
- CHEK2 (6)
- COL1A1 (6)
- CS (6)
- CTNNB1 (6)
- ENO1 (6)
- ENO3 (6)
- GSK3B (6)
- GSTP1 (6)
- KLF4 (6)
- LAMP1 (6)
- LDHB (6)
- MAPK1 (6)
- MAPK8 (6)
- MTOR (6)
- MYC (6)
- NFKBIA (6)
- PECAM1 (6)
- RPS6 (6)
- S PROTEIN (6)
- SMAD3 (6)
- TNFAIP3 (6)
- VCL (6)
- ACHE (5)
- BAD (5)
- BCL6 (5)
- BRCA1 (5)
- CASP8 (5)
- CD247 (5)
- CDK4 (5)
- CDKN2A (5)
- CFLAR (5)
- COL1A2 (5)
- COL3A1 (5)
- CYCS (5)
- DFFB (5)
- E2F1 (5)
- ESR1 (5)
- GAP43 (5)
- HDAC1 (5)
- HDAC2 (5)
- HDAC5 (5)
- HISTONE H2A (5)
- HSPB1 (5)
- IFITM3 (5)
- IKBKG (5)
- LGALS3 (5)
- MAP2K1 (5)
- MAPK14 (5)
- MCL1 (5)
- MCM5 (5)
- MEF2A (5)
- NOTCH1 (5)
- NPM1 (5)
- PDIA3 (5)
- PGAM2 (5)
Reactivities
- Human (7090)
- Mouse (5557)
- Rat (4591)
- Bovine (321)
- Monkey (128)
- Pig (127)
- Chicken (119)
- Rhesus Monkey (101)
- Xenopus (81)
- Zebrafish (69)
- X. tropicalis (58)
- Canine (57)
- Dog (56)
- Chimpanzee (43)
- Hamster (37)
- Rabbit (32)
- Cow (22)
- Primate (19)
- Feline (18)
- Sheep (15)
- Porcine (10)
- SARS-CoV-2 (7)
- Drosophila (6)
- Broad (5)
- Goat (5)
- Guinea Pig (5)
- Mammalian (3)
- C. elegans (2)
- Equine (2)
- Fusion proteins containing the Flag Tag (2)
- Carp (1)
- Drosophila melanogaster (1)
- Fish (1)
- Horse (1)
- Medaka fish (1)
- Orang-Utan (1)
- Quail (1)
- SARS-CoV (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Streptococcus Pyogenes (1)
- Yeast (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (2518)
- Phospho-specific (143)
- Acetyl K5 (3)
- Acetyl K12 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S70 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (2199)
- Transmembrane (1041)
- Transcription Factors (560)
- Secreted Protein (263)
- Protein Kinase (262)
- ES Cell Differentiation/IPS (200)
- GPCR (175)
- Stem cell - Pluripotency (168)
- Protease (115)
- Embryonic stem cells (44)
- Adult stem cells (40)
- Induced pluripotent stem cells (33)
- Nuclear Hormone Receptor (33)
- Phosphatase (30)
- Cancer stem cells (22)
- Ion Channels: Other (21)
- Stem cell relevant signaling - JAK/STAT signaling pathway (20)
- P450 (18)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (12)
- Ion Channels: Glutamate Receptors (10)
- Stem cell relevant signaling - DSL/Notch pathway (10)
- Ion Channels: Potassium (6)
- Stem cell relevant signaling - Wnt Signaling pathway (6)
- Ion Channels: Transient receptor potential (5)
- Ion Channels: Calcium (2)
- Ion Channels: Cyclic nucleotide gated (2)
- Ion Channels: Cys-loop Receptors (2)
- Ion Channels: ATP Receptors (1)
Pathways
- Pathways in cancer (267)
- Metabolic pathways (246)
- MAPK signaling pathway (127)
- Neuroactive ligand-receptor interaction (127)
- Focal adhesion (124)
- Neurotrophin signaling pathway (112)
- Cytokine-cytokine receptor interaction (110)
- Apoptosis (106)
- Olfactory transduction (103)
- Prostate cancer (97)
- Insulin signaling pathway (95)
- Chemokine signaling pathway (94)
- Colorectal cancer (94)
- Small cell lung cancer (93)
- Toll-like receptor signaling pathway (93)
- Cell cycle (90)
- Chronic myeloid leukemia (85)
- Alzheimer's disease (82)
- Regulation of actin cytoskeleton (82)
- Huntington's disease (79)
- Pancreatic cancer (76)
- RIG-I-like receptor signaling pathway (72)
- Wnt signaling pathway (72)
- Endocytosis (71)
- Adipocytokine signaling pathway (69)
- T cell receptor signaling pathway (67)
- Calcium signaling pathway (66)
- Systemic lupus erythematosus (66)
- p53 signaling pathway (66)
- Jak-STAT signaling pathway (64)
- ErbB signaling pathway (63)
- Leukocyte transendothelial migration (62)
- Acute myeloid leukemia (60)
- Progesterone-mediated oocyte maturation (60)
- NOD-like receptor signaling pathway (58)
- Non-small cell lung cancer (58)
- Endometrial cancer (57)
- Melanoma (57)
- Glioma (56)
- Oocyte meiosis (56)
- Ubiquitin mediated proteolysis (55)
- Parkinson's disease (53)
- mTOR signaling pathway (53)
- B cell receptor signaling pathway (52)
- Renal cell carcinoma (49)
- Adherens junction (48)
- Natural killer cell mediated cytotoxicity (48)
- Amyotrophic lateral sclerosis (ALS) (46)
- Gap junction (46)
- Axon guidance (44)
- Tight junction (44)
- VEGF signaling pathway (44)
- Cytosolic DNA-sensing pathway (43)
- Epithelial cell signaling in Helicobacter pylori infection (43)
- Bladder cancer (42)
- Fc gamma R-mediated phagocytosis (42)
- Melanogenesis (42)
- Pathogenic Escherichia coli infection (42)
- Glycolysis / Gluconeogenesis (40)
- ECM-receptor interaction (38)
- TGF-beta signaling pathway (37)
- Vascular smooth muscle contraction (35)
- Basal cell carcinoma (33)
- Viral myocarditis (33)
- Notch signaling pathway (32)
- Purine metabolism (32)
- Regulation of autophagy (32)
- Type II diabetes mellitus (32)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (31)
- Complement and coagulation cascades (31)
- Fc epsilon RI signaling pathway (31)
- Antigen processing and presentation (30)
- GnRH signaling pathway (30)
- Long-term potentiation (30)
- Cell adhesion molecules (CAMs) (29)
- Lysosome (28)
- Hematopoietic cell lineage (26)
- Spliceosome (26)
- Dilated cardiomyopathy (24)
- Oxidative phosphorylation (24)
- Thyroid cancer (23)
- Hypertrophic cardiomyopathy (HCM) (22)
- PPAR signaling pathway (22)
- Prion diseases (22)
- Metabolism of xenobiotics by cytochrome P450 (20)
- Pyruvate metabolism (20)
- RNA degradation (20)
- Vibrio cholerae infection (20)
- Base excision repair (19)
- Phosphatidylinositol signaling system (19)
- Citrate cycle (TCA cycle) (18)
- Hedgehog signaling pathway (18)
- Long-term depression (18)
- Inositol phosphate metabolism (17)
- Primary immunodeficiency (17)
- Pyrimidine metabolism (17)
- Ribosome (17)
- Arginine and proline metabolism (15)
- Cardiac muscle contraction (14)
- DNA replication (14)
- Drug metabolism - cytochrome P450 (13)
- Non-homologous end-joining (13)
- Nucleotide excision repair (13)
- Type I diabetes mellitus (13)
- Glutathione metabolism (12)
- Glycerolipid metabolism (12)
- Maturity onset diabetes of the young (12)
- Arachidonic acid metabolism (11)
- Cysteine and methionine metabolism (11)
- Homologous recombination (11)
- Taste transduction (11)
- Mismatch repair (10)
- Propanoate metabolism (10)
- Retinol metabolism (10)
- Tyrosine metabolism (10)
- Valine (10)
- Alanine (9)
- Fatty acid metabolism (9)
- Glycerophospholipid metabolism (9)
- aspartate and glutamate metabolism (9)
- Butanoate metabolism (8)
- Dorso-ventral axis formation (8)
- Glyoxylate and dicarboxylate metabolism (8)
- Proteasome (8)
- Renin-angiotensin system (8)
- Amino sugar and nucleotide sugar metabolism (7)
- Fructose and mannose metabolism (7)
- Glycine (7)
- Histidine metabolism (7)
- Nitrogen metabolism (7)
- O-Glycan biosynthesis (7)
- Primary bile acid biosynthesis (7)
- serine and threonine metabolism (7)
- Allograft rejection (6)
- Biosynthesis of unsaturated fatty acids (6)
- Drug metabolism - other enzymes (6)
- Graft-versus-host disease (6)
- Pentose phosphate pathway (6)
- Selenoamino acid metabolism (6)
- leucine and isoleucine degradation (6)
- Aminoacyl-tRNA biosynthesis (5)
- Autoimmune thyroid disease (5)
- Basal transcription factors (5)
- Folate biosynthesis (5)
- Linoleic acid metabolism (5)
- N-Glycan biosynthesis (5)
- Sphingolipid metabolism (5)
- Tryptophan metabolism (5)
- beta-Alanine metabolism (5)
- Androgen and estrogen metabolism (4)
- Asthma (4)
- C21-Steroid hormone metabolism (4)
- Circadian rhythm - mammal (4)
- Lysine degradation (4)
- Porphyrin and chlorophyll metabolism (4)
- RNA polymerase (4)
- Terpenoid backbone biosynthesis (4)
- leucine and isoleucine biosynthesis (4)
- ABC transporters (3)
- Fatty acid biosynthesis (3)
- Galactose metabolism (3)
- Glycosaminoglycan degradation (3)
- Heparan sulfate biosynthesis (3)
- Nicotinate and nicotinamide metabolism (3)
- Riboflavin metabolism (3)
- SNARE interactions in vesicular transport (3)
- Taurine and hypotaurine metabolism (3)
- D-Glutamine and D-glutamate metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Keratan sulfate biosynthesis (2)
- Limonene and pinene degradation (2)
- Methane metabolism (2)
- One carbon pool by folate (2)
- Other glycan degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Phenylalanine metabolism (2)
- Synthesis and degradation of ketone bodies (2)
- Ascorbate and aldarate metabolism (1)
- Caffeine metabolism (1)
- Chondroitin sulfate biosynthesis (1)
- Ether lipid metabolism (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- O-Mannosyl glycan biosynthesis (1)
- Pentose and glucuronate interconversions (1)
- Starch and sucrose metabolism (1)
- Sulfur metabolism (1)
- Vitamin B6 metabolism (1)