Antibodies

View as table Download

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.

Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-LILRB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LILRB2

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

CTLA4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 50-78 amino acids from the N-terminal region of Human CD152 / CTLA4.

Rabbit Polyclonal Nephrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin.

LRRC32 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 234~260 amino acids from the Center region of Human GARP.

Rabbit Polyclonal RHBDD2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2.

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE

Rabbit Polyclonal Antibody against XCT

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50).

Rabbit Polyclonal STIM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1.

Rabbit anti-LAMP1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LAMP1

Rabbit polyclonal anti-ELOVL5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELOVL5.

Rabbit polyclonal HLA-G Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit anti-HMOX1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HMOX1

Rabbit Polyclonal Antibody against SR-BI

Applications IF, IHC, WB
Reactivities Hamster, Human, Mink, Mouse, Rat
Conjugation Unconjugated
Immunogen A C-terminal peptide containing residues from mouse Scavenger Receptor-BI (within residues 450-509).

Rabbit polyclonal antibody to Bcl-B (BCL2-like 10 (apoptosis facilitator))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 60 and 153 of BCL2L10 (Uniprot ID#Q9HD36)

Rabbit Polyclonal VMAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]

Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G).
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

CD133 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen C term -peptide of human CD133

PBR (TSPO) (C-term) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide C-RDNSGRRGGSRLPE from the C-terminus of Mouse TSPO (NP_033905.3).
Percent identity with other species by BLAST analysis: Mouse (100%), Rat (93%). 
C-Terminus

Rabbit Polyclonal Antibody against CD19 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19.

Rabbit polyclonal antibody to GPR120 (G protein-coupled receptor 120)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 71 of GPR120 (Uniprot ID#Q5NUL3)

Rabbit Polyclonal anti-TLR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Developed against a synthetic peptide corresponding to amino acids 420-435 of human TLR4.

Rabbit polyclonal PECAM-1 (Ab-713) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).

Rabbit Polyclonal Anti-P2Y1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide SDEYLRSYFIYSMC, corresponding to amino acid residues 207-220 of human P2Y1 Receptor. 2nd extracellular loop.

Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC, WB
Reactivities Rat
Immunogen D2s (Ac239-Cys247) covalently attached to a carrier protein

Rabbit Polyclonal Niemann-Pick type C1 Like-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of rat NPC1L1(between residues 500-600).

Rabbit polyclonal ROR2 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2.

Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains.

DLL4 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Immunogen Synthetic peptide corresponding to the internal region of human DLL4.

Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic Prepro-NPY 68-97 (C-PON).

PTCH1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1)

Rabbit Polyclonal TLR2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2.

Rabbit Polyclonal TRPC6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6.

Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin.

NOTCH2 (2457-2471) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from human NOTCH2 (aa 2457-2471)

Rabbit polyclonal Syndecan4 (Ab-179) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D).

Rabbit polyclonal anti-B3GALTL antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human B3GALTL.

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).

Rabbit polyclonal ERBB2 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ErbB2 antibody is generated from rabbits immunized with human recombinant ErbB2 protein.

CD274 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD274