Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

Goat Anti-Rabbit IgG Secondary Antibody

Applications WB, IHC, IF/ICC, ELISA
Reactivities Rabbit IgG
Conjugation Unconjugated
Immunogen Rabbit IgG, whole molecule

Lyve1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Mouse, Rat
Immunogen Highly pure (> 95%) recombinant Mouse soluble LYVE-1 (Ala24-Gly228) produced in insect cells (Cat.-No DA3524).

Goat Anti-Mouse IgG Secondary Antibody

Applications WB, IHC, IF/ICC, ELISA
Reactivities Mouse IgG
Conjugation Unconjugated
Immunogen Mouse IgG, whole molecule

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Biotin Conjugated Goat Anti-Rabbit IgG

Applications WB: 1:200-400; ICC: 1:100-200; IHC: 1:100-200; ELISA: 1:5,000-20,000
Reactivities Rabbit IgG
Conjugation Biotin
Immunogen Rabbit IgG, whole molecule

Rabbit Polyclonal Antibody against LC3B

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein.

Vsx2 (N-term) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Mouse, Rat
Immunogen A recombinant protein corresponding to amino acids 1 to 131 derived from the N-terminal of the Human Chx10 protein conjugated to GST.

Rabbit Anti-Mouse IgG Secondary Antibody

Applications WB, IHC, IF/ICC, ELISA
Reactivities Mouse IgG
Conjugation Unconjugated
Immunogen Mouse IgG, whole molecule

Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat, Sheep
Immunogen Collagen type II purified from Human knee and Bovine nasal cartilage.

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.

Rabbit Polyclonal Anti-NOX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4.

Goat Anti-GATA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1.

Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L).
Modifications Phospho-specific

Rabbit Polyclonal VLK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK.

Rabbit Polyclonal Dact2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Dact2 antibody was raised against a 12 amino acid peptide from near the amino terminus of human DACT2.

Rabbit Polyclonal Anti-LILRB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LILRB2

GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities A. victoria
Immunogen Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria

Rabbit anti-BRCA1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).

Rabbit Polyclonal Anti-NGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NGF

Rabbit Polyclonal OCLN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN.

Rabbit anti-ZEB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ZEB1

Vsx2 (C-term) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Mouse, Rat
Immunogen A recombinant protein corresponding to amino acids 264 to 361 derived from the C terminal of the Human Chx10 protein conjugated to KLH.

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Iba1 (149-161) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.

Applications ELISA, IHC, WB
Reactivities Hamster, Human, Monkey, Mouse, Porcine, Rat, Bovine, Equine, Goat, Rabbit, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-TGPPAKKAISELP, from the C-Terminus of protein sequence according to NP_116573.1NP_001614.3.

Rabbit Polyclonal Antibody against LC3

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 50-150).

Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2.

Rabbit Polyclonal Nephrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin.

USD 320.00

In Stock

Goat Polyclonal Anti-Rab27a Antibody

Applications IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli.

Rabbit Polyclonal RHBDD2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2.

Rabbit Polyclonal FOXP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3.

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE

Biotin Conjugated Goat Anti-Mouse IgG

Applications WB: 1:200-400; ICC: 1:100-200; IHC: 1:100-200; ELISA: 1:5,000-20,000
Reactivities Mouse IgG
Conjugation Biotin
Immunogen Mouse IgG, whole molecule

Rabbit Anti-Goat IgG Secondary Antibody

Applications WB, IHC, IF/ICC, ELISA
Reactivities Goat IgG
Conjugation Unconjugated
Immunogen Goat IgG, whole molecule

Rabbit Polyclonal Antibody against XCT

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50).

Rabbit Polyclonal STIM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1.

Rabbit Polyclonal antibody to ZKSCAN3 (zinc finger with KRAB and SCAN domains 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 394 of ZKSCAN3 (Uniprot ID#Q9BRR0)

Rabbit polyclonal anti-p15 INK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p15 INK antibody.

Rabbit polyclonal HAPLN1 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HAPLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-38 amino acids from the N-terminal region of human HAPLN1.

Biotin Conjugated Goat Anti-Rabbit IgG

Applications WB: 1:200-400; ICC: 1:100-200; IHC: 1:100-200; ELISA: 1:5,000-20,000
Reactivities Rabbit IgG
Conjugation Biotin
Immunogen Rabbit IgG, whole molecule

Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561)

Rabbit polyclonal Collagen II antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Collagen II.

Rabbit polyclonal DAPK1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1.

Rabbit polyclonal anti-HSP90AA1(HSP90) antibody, Loading control

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSP90AA1

Rabbit anti-LAMP1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LAMP1

Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K).
Modifications Phospho-specific