Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
USD 524.00
In Stock
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Active filters
Category
- Antibodies
Reactivities
- Rat
Applications
- IHC
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (173)
- ERBB2 (99)
- CTNNB1 (71)
- AKT1 (64)
- JUN (63)
- BCL2 (50)
- PARVA (50)
- PIK3CG (50)
- PIK3R5 (35)
- EGFR (31)
- MAPK1 (29)
- MAPK9 (27)
- HRAS (26)
- PARVB (25)
- PIK3CD (25)
- BCAR1 (24)
- BRAF (24)
- HGF (21)
- PIK3CA (21)
- FN1 (17)
- PTK2 (17)
- MET (15)
- MYL7 (15)
- PDGFRA (15)
- RAPGEF1 (15)
- VASP (14)
- MAPK8 (13)
- SHC1 (13)
- IGF1 (12)
- VEGFB (12)
- ITGB3 (11)
- AKT3 (9)
- AKT2 (8)
- BAD (8)
- PAK1 (8)
- ACTN1 (7)
- MAPK3 (7)
- PDGFRB (7)
- PTEN (7)
- CAV1 (6)
- KDR (6)
- PAK4 (6)
- PPP1CA (6)
- SRC (6)
- VEGFC (6)
- ACTB (5)
- CAPN2 (5)
- LAMA4 (5)
- LAMB2 (5)
- PRKCA (5)
- PXN (5)
- RAF1 (5)
- GSK3B (4)
- IGF1R (4)
- ILK (4)
- PAK2 (4)
- PIK3R1 (4)
- PPP1CB (4)
- ROCK2 (4)
- SPP1 (4)
- CCND1 (3)
- CCND3 (3)
- COL3A1 (3)
- ELK1 (3)
- GRB2 (3)
- LAMA1 (3)
- PAK5 (3)
- PDPK1 (3)
- TNC (3)
- VEGFA (3)
- BIRC2 (2)
- CAV3 (2)
- CCND2 (2)
- COL2A1 (2)
- COL4A1 (2)
- EGF (2)
- ITGA7 (2)
- ITGB1 (2)
- ITGB4 (2)
- LAMA3 (2)
- MYL9 (2)
- PAK3 (2)
- PDGFA (2)
- PDGFB (2)
- PPP1CC (2)
- PRKCB (2)
- RAC1 (2)
- RAP1A (2)
- RAP1B (2)
- ROCK1 (2)
- TNN (2)
- TNR (2)
- TNXB (2)
- VCL (2)
- VWF (2)
- XIAP (2)
- ACTG1 (1)
- ACTN2 (1)
- ACTN4 (1)
- CAV2 (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1269)
- Protein Kinase (611)
- ES Cell Differentiation/IPS (517)
- Transmembrane (279)
- Transcription Factors (139)
- Secreted Protein (109)
- Stem cell - Pluripotency (82)
- Adult stem cells (55)
- Stem cell relevant signaling - JAK/STAT signaling pathway (40)
- Cancer stem cells (31)
- Protease (26)
- Phosphatase (19)
- Embryonic stem cells (3)
- Induced pluripotent stem cells (3)
- Stem cell relevant signaling - DSL/Notch pathway (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)