Germany
Japan
United Kingdom
China
Antibodies
Download
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
.jpg?d=110x100 "User supplied image")
Goat Anti-Rabbit IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Rabbit IgG |
| Conjugation | Unconjugated |
| Immunogen | Rabbit IgG, whole molecule |
Goat Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
USD 479.00
2 Weeks
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal TET1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human TET1 protein (between residues 1700 to 1800) [UniProt Q8NFU7] |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Anti-Goat IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Goat IgG |
| Conjugation | Unconjugated |
| Immunogen | Goat IgG, whole molecule |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Citations
- Yes
Filter by
Target Symbol
- MKI67 (9)
- TP53 (9)
- GAPDH (7)
- VIM (7)
- LGR5 (6)
- BAX (5)
- CD19 (5)
- CDH2 (5)
- CHGA (5)
- PECAM1 (5)
- ZEB1 (5)
- ALDH1A3 (4)
- BECN1 (4)
- CCN2 (4)
- CD163 (4)
- CD274 (4)
- CD4 (4)
- CD8A (4)
- CTNNB1 (4)
- ERBB2 (4)
- GBE1 (4)
- LTA4H (4)
- MAPK1 (4)
- MME (4)
- NIT2 (4)
- PDE10A (4)
- PRRX1 (4)
- RELA (4)
- SAMHD1 (4)
- SH2D2A (4)
- SLC7A8 (4)
- SNAI2 (4)
- SPP1 (4)
- UNG (4)
- AKT1 (3)
- ALK (3)
- BCL2 (3)
- BIRC5 (3)
- CD34 (3)
- CD3E (3)
- CD44 (3)
- CD68 (3)
- CDH1 (3)
- CDH3 (3)
- CDKN2A (3)
- EPAS1 (3)
- EPCAM (3)
- ERCC1 (3)
- FGF2 (3)
- GBA (3)
- HNRNPM (3)
- HSPA1A (3)
- HSPD1 (3)
- IDO1 (3)
- IL1B (3)
- KRT18 (3)
- KRT8 (3)
- LAMB3 (3)
- MGMT (3)
- MS4A1 (3)
- MSR1 (3)
- NCAM1 (3)
- NOTCH1 (3)
- NR4A3 (3)
- PARP1 (3)
- PDCD1 (3)
- PPP4C (3)
- SLC18A2 (3)
- SOX17 (3)
- STAT3 (3)
- TMEM100 (3)
- ZEB2 (3)
- ABCC4 (2)
- ABCD1 (2)
- ABCG2 (2)
- ACAA2 (2)
- ACTN1 (2)
- ADH1B (2)
- ADIPOQ (2)
- AKT3 (2)
- ALDH3A1 (2)
- ALOX15 (2)
- ANXA1 (2)
- ANXA3 (2)
- AOX1 (2)
- APMAP (2)
- APOE (2)
- APPL1 (2)
- AQP1 (2)
- ARNT (2)
- ARNTL (2)
- ATP5PO (2)
- B3GNT2 (2)
- BAG3 (2)
- BCAT1 (2)
- BCL2L1 (2)
- BDNF (2)
- BID (2)
- BTK (2)
- BTN3A2 (2)
Reactivities
- Human (1050)
- Mouse (719)
- Rat (641)
- Monkey (142)
- Dog (124)
- Bovine (25)
- Pig (14)
- Rabbit (11)
- Xenopus (10)
- Canine (7)
- Gorilla (7)
- Hamster (7)
- Porcine (6)
- Primate (6)
- Rhesus Monkey (6)
- Chicken (5)
- Zebrafish (5)
- Chimpanzee (4)
- Horse (4)
- Bat (3)
- Cow (3)
- X. tropicalis (3)
- Drosophila (2)
- Gibbon (2)
- Guinea Pig (2)
- Sheep (2)
- Escherichia coli (1)
- Feline (1)
- Helicobacter pylori (1)
- Mink (1)
- Murine (1)
- Orang-Utan (1)
- Salmonella Typhimurium (1)
- Spinach (1)
- Tadpole (1)
- Trichinella spiralis (1)
- White Fly (1)
- Yeast (1)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (738)
- Transmembrane (307)
- Transcription Factors (151)
- ES Cell Differentiation/IPS (147)
- Secreted Protein (114)
- Protein Kinase (71)
- Stem cell - Pluripotency (45)
- Protease (41)
- Adult stem cells (35)
- Embryonic stem cells (21)
- GPCR (20)
- Cancer stem cells (17)
- P450 (16)
- Induced pluripotent stem cells (15)
- Phosphatase (11)
- Nuclear Hormone Receptor (9)
- Ion Channels: Transient receptor potential (8)
- Stem cell relevant signaling - DSL/Notch pathway (8)
- Ion Channels: Other (6)
- Stem cell relevant signaling - JAK/STAT signaling pathway (3)
- Ion Channels: Cys-loop Receptors (2)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Potassium (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Pathways in cancer (133)
- Metabolic pathways (119)
- MAPK signaling pathway (66)
- Focal adhesion (65)
- Cell adhesion molecules (CAMs) (59)
- Prostate cancer (55)
- Colorectal cancer (52)
- Neurotrophin signaling pathway (52)
- Pancreatic cancer (51)
- Apoptosis (48)
- Hematopoietic cell lineage (47)
- Small cell lung cancer (46)
- Melanoma (44)
- Chronic myeloid leukemia (43)
- T cell receptor signaling pathway (43)
- Toll-like receptor signaling pathway (42)
- Endometrial cancer (41)
- Regulation of actin cytoskeleton (40)
- Adherens junction (39)
- Alzheimer's disease (38)
- Glioma (38)
- Huntington's disease (38)
- Bladder cancer (37)
- Chemokine signaling pathway (37)
- Non-small cell lung cancer (36)
- p53 signaling pathway (36)
- B cell receptor signaling pathway (32)
- Prion diseases (31)
- Renal cell carcinoma (31)
- Amyotrophic lateral sclerosis (ALS) (30)
- ErbB signaling pathway (30)
- Insulin signaling pathway (29)
- Leukocyte transendothelial migration (28)
- Progesterone-mediated oocyte maturation (28)
- Thyroid cancer (28)
- Acute myeloid leukemia (27)
- Endocytosis (27)
- ECM-receptor interaction (26)
- Primary immunodeficiency (26)
- VEGF signaling pathway (26)
- Adipocytokine signaling pathway (25)
- Cytokine-cytokine receptor interaction (25)
- Natural killer cell mediated cytotoxicity (24)
- Glycolysis / Gluconeogenesis (22)
- Fc gamma R-mediated phagocytosis (21)
- Jak-STAT signaling pathway (21)
- NOD-like receptor signaling pathway (21)
- Tight junction (21)
- Wnt signaling pathway (21)
- Axon guidance (20)
- Cell cycle (20)
- Drug metabolism - cytochrome P450 (20)
- Fc epsilon RI signaling pathway (20)
- Gap junction (20)
- Parkinson's disease (20)
- Basal cell carcinoma (19)
- Cytosolic DNA-sensing pathway (19)
- Antigen processing and presentation (18)
- Lysosome (18)
- Pathogenic Escherichia coli infection (18)
- Viral myocarditis (18)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (17)
- Melanogenesis (17)
- Arachidonic acid metabolism (16)
- GnRH signaling pathway (16)
- Metabolism of xenobiotics by cytochrome P450 (16)
- Purine metabolism (16)
- Type II diabetes mellitus (16)
- Ubiquitin mediated proteolysis (16)
- Dorso-ventral axis formation (15)
- Epithelial cell signaling in Helicobacter pylori infection (15)
- RIG-I-like receptor signaling pathway (15)
- Type I diabetes mellitus (15)
- mTOR signaling pathway (15)
- Calcium signaling pathway (14)
- Oocyte meiosis (14)
- TGF-beta signaling pathway (14)
- Tyrosine metabolism (14)
- Vascular smooth muscle contraction (13)
- Complement and coagulation cascades (12)
- Hypertrophic cardiomyopathy (HCM) (12)
- Dilated cardiomyopathy (11)
- Graft-versus-host disease (11)
- Long-term depression (11)
- Long-term potentiation (11)
- Neuroactive ligand-receptor interaction (11)
- Retinol metabolism (11)
- Autoimmune thyroid disease (10)
- Base excision repair (10)
- Tryptophan metabolism (10)
- Histidine metabolism (9)
- Oxidative phosphorylation (9)
- Alanine (8)
- Allograft rejection (8)
- Fatty acid metabolism (8)
- Pyrimidine metabolism (8)
- Valine (8)
- aspartate and glutamate metabolism (8)
- leucine and isoleucine degradation (8)
- ABC transporters (7)
- Cardiac muscle contraction (7)
- Cysteine and methionine metabolism (7)
- Linoleic acid metabolism (7)
- Spliceosome (7)
- Starch and sucrose metabolism (7)
- Arginine and proline metabolism (6)
- Hedgehog signaling pathway (6)
- Nucleotide excision repair (6)
- PPAR signaling pathway (6)
- Phenylalanine metabolism (6)
- Regulation of autophagy (6)
- Sphingolipid metabolism (6)
- Systemic lupus erythematosus (6)
- beta-Alanine metabolism (6)
- Citrate cycle (TCA cycle) (5)
- Inositol phosphate metabolism (5)
- Other glycan degradation (5)
- Phosphatidylinositol signaling system (5)
- RNA degradation (5)
- Renin-angiotensin system (5)
- Butanoate metabolism (4)
- Fructose and mannose metabolism (4)
- Nitrogen metabolism (4)
- Pantothenate and CoA biosynthesis (4)
- Primary bile acid biosynthesis (4)
- Propanoate metabolism (4)
- Pyruvate metabolism (4)
- Sulfur metabolism (4)
- Androgen and estrogen metabolism (3)
- Asthma (3)
- Circadian rhythm - mammal (3)
- Drug metabolism - other enzymes (3)
- Galactose metabolism (3)
- Glutathione metabolism (3)
- Methane metabolism (3)
- Notch signaling pathway (3)
- One carbon pool by folate (3)
- Porphyrin and chlorophyll metabolism (3)
- Taurine and hypotaurine metabolism (3)
- Vibrio cholerae infection (3)
- C21-Steroid hormone metabolism (2)
- Caffeine metabolism (2)
- Fatty acid elongation in mitochondria (2)
- Folate biosynthesis (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Homologous recombination (2)
- Keratan sulfate biosynthesis (2)
- Maturity onset diabetes of the young (2)
- Mismatch repair (2)
- N-Glycan biosynthesis (2)
- Nicotinate and nicotinamide metabolism (2)
- Non-homologous end-joining (2)
- Pentose phosphate pathway (2)
- SNARE interactions in vesicular transport (2)
- Selenoamino acid metabolism (2)
- Vitamin B6 metabolism (2)
- leucine and isoleucine biosynthesis (2)
- Ascorbate and aldarate metabolism (1)
- Biosynthesis of unsaturated fatty acids (1)
- Chondroitin sulfate biosynthesis (1)
- DNA replication (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycine (1)
- Glycosaminoglycan degradation (1)
- Limonene and pinene degradation (1)
- Lysine degradation (1)
- O-Glycan biosynthesis (1)
- Proteasome (1)
- Riboflavin metabolism (1)
- Steroid biosynthesis (1)
- Thiamine metabolism (1)
- serine and threonine metabolism (1)