Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-CTNNA1 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNNA1 |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal anti-NOM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOM1. |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CTNA1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CTNA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-59 amino acids from the N-terminal region of human CTNA1. |
CD61 (ITGB3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 741-790 of Human Integrin β3. |
Integrin alpha 1 (ITGA1) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 727-755 amino acids from the Central region of human ITGA1. |
Lamin A (N-Terminus) rabbit polyclonal antibody, Affinity purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide made from the last 8 amino acids of Lamin C, including an N-Terminus lysine as a linker (KHHVSGSRR), coupled to KLH |
Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6. |
gamma Catenin (JUP) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human Cateninγ |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Filter by
Category
Target Symbol
- CTNNB1 (14)
- GJA1 (9)
- JUP (9)
- LMNA (8)
- ITGA6 (7)
- DES (5)
- ITGB3 (5)
- SHC1 (5)
- CTNNA1 (4)
- ITGA4 (4)
- ITGB1 (4)
- ACTN1 (3)
- ACTN4 (3)
- CACNA1C (3)
- DSP (3)
- ITGA2 (3)
- ITGB4 (3)
- CACNB1 (2)
- EMD (2)
- ITGA2B (2)
- ITGA3 (2)
- ITGA7 (2)
- ITGAV (2)
- LEF1 (2)
- RYR2 (2)
- TCF7 (2)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNA2D2 (1)
- CACNB2 (1)
- CACNG5 (1)
- CACNG6 (1)
- CACNG8 (1)
- CDH2 (1)
- ITGA1 (1)
- ITGA11 (1)
- ITGA5 (1)
- ITGA8 (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- SGCA (1)
- SGCB (1)
- TCF7L1 (1)