Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Rabbit Polyclonal Anti-ILK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ILK |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
CYP27A1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1. |
Rabbit anti-CPT1A Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CPT1A |
Rabbit Polyclonal Anti-ADIPOQ Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADIPOQ |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit Polyclonal Antibody against CD36
Applications | IHC, WB |
Reactivities | Human, Bovine, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide mapping to a region of human CD36 between residues 100-200. |
PPARG Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human PPARG |
Rabbit Polyclonal UCP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UCP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human UCP1 (GenBank accession. |
FABP4 (1-30) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH-conjugated synthetic peptide between amino acids 1-30 from human FABP4 |
UBC / Ubiquitin C Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | UBC / Ubiquitin C antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of human Ubiquitin. |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |
Rabbit anti-PPARD Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPARD |
Rabbit Polyclonal Anti-CPT1B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
Perilipin-1 (PLIN1) (488-499) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey |
Immunogen | Synthetic peptide from internal region of human PLIN |
Rabbit anti-ILK Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ILK |
Rabbit anti-PDPK1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human PDPK1 |
Rabbit Polyclonal PCK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
ACADM rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM. |
Apolipoprotein A I (APOA1) goat polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Mouse |
Immunogen | Apolipoprotein Type A-I was isolated from mouse plasma by density gradient centrifugation followed by HPLC purification |
Apolipoprotein CIII (APOC3) (N-term) goat polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | APOC3 Recombinant protein from the N-terminus |
Rabbit polyclonal anti-CPT1B antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPT1B. |
UBC / Ubiquitin C Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | UBC / Ubiquitin C antibody was raised against kLH conjugated synthetic peptide selected from the N-terminal region of human Ubiquitin. |
Rabbit anti-ANGPTL4 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANGPTL4 |
Retinoid X Receptor gamma (RXRG) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 150-250 of Human RXRγ. |
CPT1A (621-634) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CPT1A |
Perilipin-1 (PLIN1) (C-term) goat polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Equine, Human, Monkey, Mouse |
Immunogen | Synthetic peptide from (C-term) of human PLIN |
Apolipoprotein A I (APOA1) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Mouse |
Immunogen | Apo AI isolated from mouse plasma |
Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Human Apo AII |
PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Immunogen | Synthetic peptide from the C-terminus of human PPARD |
LXR alpha (NR1H3) (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | NR1H3 antibody was raised against synthetic peptide - KLH conjugated |
PDPK1 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
Angiopoietin like 4 (ANGPTL4) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 145~175 amino acids from the Center region of human ANGPTL4 |
Rabbit Polyclonal Adiponectin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Adiponectin antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human adiponectin. The immunogen is located within the last 50 amino acids of Adiponectin. |
Rabbit Polyclonal LXR-A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LXR-A antibody was raised against a 15 amino acid peptide from near the amino terminus human LXR-A. |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit Polyclonal antibody to Glycerol kinase 2 (glycerol kinase 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 67 and 338 of Glycerol kinase 2 (Uniprot ID#Q14410) |
Rabbit polyclonal PDK1 (Tyr9) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PDK1 around the phosphorylation site of tyrosine 9 (Q-L-YP-D-A). |
Modifications | Phospho-specific |
Rabbit polyclonal ILK (Ser246) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P). |
Modifications | Phospho-specific |
Anti-PDPK1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.239~243 (A-N-S-F-V) derived from Human PDK1. |
Rabbit polyclonal MMP1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit Polyclonal Adiponectin/Acrp30 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal sequence of human Adiponectin (between amino acids 200-244) [UniProt Q15848] |
Integrin Linked Kinase (ILK) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
PCK1 (513-524) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bat, Canine, Equine, Human, Monkey, Rabbit |
Immunogen | Synthetic peptide from an internal region of human PCK1 |
CPT1B (760-772) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Synthetic peptide from C-term of human CPT1B |
FABP4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human FABP4 |
MMP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | MMP1 antibody was raised against a synthetic peptide from near C-terminal of human MMP-1 protein. |