Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
USD 428.00
In Stock
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
USD 380.00
2 Weeks
USD 428.00
In Stock
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal DNA Polymerase theta antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
Rabbit Polyclonal Anti-CRY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Active filters
Applications
- IHC
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- AKT1 (22)
- ESR1 (14)
- BAD (13)
- RELA (13)
- TP53 (13)
- CASP3 (12)
- HDAC2 (12)
- STAT1 (11)
- ATF2 (10)
- BAX (10)
- JUN (10)
- NR3C1 (10)
- APP (9)
- CASP7 (9)
- CASP9 (9)
- CREB1 (9)
- IRS1 (9)
- NFKBIA (9)
- BCL2 (8)
- BRAF (8)
- BRCA1 (8)
- EGFR (8)
- GCG (8)
- PAK1 (8)
- PTEN (8)
- SMAD3 (8)
- STAT3 (8)
- STAT5B (8)
- ACE2 (7)
- APAF1 (7)
- BDNF (7)
- CD274 (7)
- ENO1 (7)
- HSPD1 (7)
- JUND (7)
- JUP (7)
- MMP9 (7)
- MUC1 (7)
- STAT6 (7)
- VASP (7)
- XRCC6 (7)
- ALK (6)
- AR (6)
- ATG5 (6)
- BCL2L1 (6)
- BCL2L11 (6)
- CASP1 (6)
- CCNB1 (6)
- CCNE1 (6)
- CDC25A (6)
- CDH1 (6)
- CHUK (6)
- CXCR4 (6)
- DEFA1 (6)
- EIF2AK2 (6)
- ENPP3 (6)
- ERBB3 (6)
- FGFR3 (6)
- FOS (6)
- FOXO1 (6)
- G6PC1 (6)
- GNAS (6)
- GPT (6)
- GSK3B (6)
- HDAC1 (6)
- HDAC5 (6)
- KDM1A (6)
- KDR (6)
- KRT8 (6)
- LEP (6)
- LIMK2 (6)
- LOX (6)
- MAP2K6 (6)
- MAPK14 (6)
- MKI67 (6)
- MME (6)
- MMP2 (6)
- NOTCH1 (6)
- PAX8 (6)
- PRKCQ (6)
- RAB27A (6)
- RPS6KB1 (6)
- SERPINB5 (6)
- SGK1 (6)
- SRC (6)
- TAC1 (6)
- TLR8 (6)
- TNF (6)
- UCHL1 (6)
- ADD1 (5)
- ADH4 (5)
- AFP (5)
- AGER (5)
- AIF1 (5)
- AIFM1 (5)
- AKR1B1 (5)
- ALDH4A1 (5)
- ANAPC1 (5)
- ANP32A (5)
- APC (5)
Reactivities
- Human (6868)
- Mouse (4799)
- Rat (3802)
- Bovine (278)
- Monkey (207)
- Dog (196)
- Pig (180)
- Gorilla (116)
- Rabbit (104)
- Gibbon (90)
- Chicken (78)
- Horse (70)
- Cow (68)
- Hamster (65)
- Rhesus Monkey (63)
- Xenopus (59)
- Chimpanzee (52)
- Bat (51)
- X. tropicalis (41)
- Zebrafish (39)
- Orang-Utan (21)
- Canine (17)
- Guinea Pig (15)
- Primate (13)
- Feline (9)
- Sheep (9)
- Macaque (8)
- Porcine (6)
- Drosophila (3)
- Goat (2)
- Murine (2)
- All Species (1)
- C. elegans (1)
- Equine (1)
- Escherichia coli (1)
- Ferret (1)
- Mammalian (1)
- Medaka fish (1)
- Quail (1)
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (789)
- Metabolic pathways (569)
- MAPK signaling pathway (472)
- Focal adhesion (383)
- Cytokine-cytokine receptor interaction (372)
- Chemokine signaling pathway (351)
- Neurotrophin signaling pathway (327)
- Neuroactive ligand-receptor interaction (313)
- Prostate cancer (312)
- Apoptosis (280)
- Colorectal cancer (274)
- Regulation of actin cytoskeleton (269)
- Cell cycle (264)
- Chronic myeloid leukemia (264)
- Pancreatic cancer (262)
- Toll-like receptor signaling pathway (260)
- Jak-STAT signaling pathway (250)
- T cell receptor signaling pathway (249)
- Insulin signaling pathway (247)
- ErbB signaling pathway (241)
- Small cell lung cancer (230)
- Wnt signaling pathway (224)
- Calcium signaling pathway (211)
- Adipocytokine signaling pathway (208)
- Progesterone-mediated oocyte maturation (203)
- Acute myeloid leukemia (196)
- Melanoma (193)
- Endometrial cancer (189)
- Alzheimer's disease (182)
- p53 signaling pathway (182)
- Glioma (179)
- B cell receptor signaling pathway (177)
- Endocytosis (174)
- Natural killer cell mediated cytotoxicity (173)
- Non-small cell lung cancer (173)
- Renal cell carcinoma (171)
- Leukocyte transendothelial migration (170)
- Oocyte meiosis (169)
- Huntington's disease (163)
- Amyotrophic lateral sclerosis (ALS) (160)
- GnRH signaling pathway (159)
- Fc gamma R-mediated phagocytosis (156)
- VEGF signaling pathway (153)
- Axon guidance (152)
- Melanogenesis (150)
- Adherens junction (144)
- Gap junction (141)
- NOD-like receptor signaling pathway (141)
- TGF-beta signaling pathway (141)
- Bladder cancer (139)
- Epithelial cell signaling in Helicobacter pylori infection (139)
- Fc epsilon RI signaling pathway (139)
- Vascular smooth muscle contraction (135)
- Tight junction (128)
- RIG-I-like receptor signaling pathway (120)
- Ubiquitin mediated proteolysis (117)
- Long-term potentiation (114)
- mTOR signaling pathway (113)
- Type II diabetes mellitus (102)
- Hematopoietic cell lineage (99)
- Cell adhesion molecules (CAMs) (97)
- Long-term depression (96)
- Basal cell carcinoma (93)
- Glycolysis / Gluconeogenesis (93)
- Dilated cardiomyopathy (90)
- Purine metabolism (88)
- ECM-receptor interaction (87)
- Complement and coagulation cascades (86)
- Hypertrophic cardiomyopathy (HCM) (79)
- Pathogenic Escherichia coli infection (78)
- Cytosolic DNA-sensing pathway (76)
- Parkinson's disease (76)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (74)
- PPAR signaling pathway (73)
- Thyroid cancer (73)
- Notch signaling pathway (66)
- Viral myocarditis (65)
- Metabolism of xenobiotics by cytochrome P450 (64)
- Lysosome (63)
- Hedgehog signaling pathway (61)
- Drug metabolism - cytochrome P450 (59)
- Prion diseases (59)
- Phosphatidylinositol signaling system (57)
- Type I diabetes mellitus (53)
- Antigen processing and presentation (52)
- Arginine and proline metabolism (49)
- ABC transporters (46)
- Base excision repair (46)
- Fatty acid metabolism (44)
- Pyruvate metabolism (43)
- Retinol metabolism (43)
- Tyrosine metabolism (42)
- Valine (42)
- Arachidonic acid metabolism (41)
- Alanine (39)
- Inositol phosphate metabolism (39)
- Vibrio cholerae infection (39)
- aspartate and glutamate metabolism (39)
- Nucleotide excision repair (38)
- Primary immunodeficiency (38)
- Systemic lupus erythematosus (38)
- Butanoate metabolism (37)
- Fructose and mannose metabolism (37)
- leucine and isoleucine degradation (37)
- Dorso-ventral axis formation (36)
- Regulation of autophagy (36)
- Allograft rejection (35)
- Glycerolipid metabolism (34)
- Homologous recombination (34)
- Starch and sucrose metabolism (34)
- Galactose metabolism (33)
- Tryptophan metabolism (33)
- Autoimmune thyroid disease (32)
- Pyrimidine metabolism (32)
- Taste transduction (32)
- Renin-angiotensin system (31)
- Graft-versus-host disease (30)
- Mismatch repair (30)
- Glutathione metabolism (29)
- Histidine metabolism (29)
- DNA replication (27)
- Androgen and estrogen metabolism (26)
- Citrate cycle (TCA cycle) (26)
- Sphingolipid metabolism (26)
- Cysteine and methionine metabolism (25)
- Maturity onset diabetes of the young (25)
- Olfactory transduction (25)
- Non-homologous end-joining (24)
- Proteasome (24)
- Propanoate metabolism (23)
- Drug metabolism - other enzymes (22)
- Amino sugar and nucleotide sugar metabolism (21)
- Cardiac muscle contraction (21)
- Lysine degradation (21)
- Pentose phosphate pathway (20)
- Glycerophospholipid metabolism (19)
- Linoleic acid metabolism (19)
- Nitrogen metabolism (19)
- SNARE interactions in vesicular transport (19)
- beta-Alanine metabolism (19)
- Phenylalanine metabolism (18)
- Porphyrin and chlorophyll metabolism (18)
- C21-Steroid hormone metabolism (17)
- Nicotinate and nicotinamide metabolism (16)
- Primary bile acid biosynthesis (16)
- Asthma (14)
- Folate biosynthesis (14)
- RNA degradation (14)
- Glycosaminoglycan degradation (12)
- Oxidative phosphorylation (12)
- Pentose and glucuronate interconversions (12)
- Riboflavin metabolism (12)
- Terpenoid backbone biosynthesis (12)
- Pantothenate and CoA biosynthesis (11)
- Synthesis and degradation of ketone bodies (11)
- Ascorbate and aldarate metabolism (10)
- Basal transcription factors (10)
- Other glycan degradation (10)
- Spliceosome (10)
- Ether lipid metabolism (9)
- Glycine (9)
- Glyoxylate and dicarboxylate metabolism (9)
- serine and threonine metabolism (9)
- Circadian rhythm - mammal (8)
- Limonene and pinene degradation (8)
- Ribosome (8)
- Taurine and hypotaurine metabolism (8)
- leucine and isoleucine biosynthesis (8)
- Aminoacyl-tRNA biosynthesis (7)
- Methane metabolism (7)
- Fatty acid biosynthesis (6)
- Selenoamino acid metabolism (6)
- Biosynthesis of unsaturated fatty acids (5)
- One carbon pool by folate (5)
- Steroid biosynthesis (5)
- Glycosphingolipid biosynthesis - ganglio series (4)
- Glycosphingolipid biosynthesis - globo series (4)
- O-Glycan biosynthesis (4)
- Caffeine metabolism (3)
- D-Glutamine and D-glutamate metabolism (3)
- Vitamin B6 metabolism (3)
- alpha-Linolenic acid metabolism (3)
- N-Glycan biosynthesis (2)
- Sulfur metabolism (2)
- Chondroitin sulfate biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Heparan sulfate biosynthesis (1)
- Phenylalanine (1)
- RNA polymerase (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)