Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD34 mouse monoclonal antibody, clone QBEnd-10, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human, Primate |
MAP2 chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Two synthetic peptides KLH conjugated corresponding to different regions of the MAP-2 gene product, but are shared between the Human (NP_002365) and Mouse (P20357) sequences. Production: After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 200 µg/ml. Finally, equal volumes of both of these affinity purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Antibody against CD14 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal PAX3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3. |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Anti-Human BMP-7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHO cells derived Recombinant Human BMP-7 |
Rabbit Polyclonal anti-GATA2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2. Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
EGFR L858R mouse monoclonal antibody,clone UMAB233
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
Active filters
Applications
- IHC
Families
- Adult stem cells
Filter by
Category
Target Symbol
- CD4 (85)
- EGFR (59)
- KIT (58)
- CD44 (47)
- GLI1 (40)
- APOE (39)
- CD8A (35)
- CD34 (34)
- CD14 (30)
- ERBB3 (26)
- GATA3 (25)
- HES1 (25)
- HGF (23)
- NOTCH1 (23)
- CDX2 (20)
- FGF21 (19)
- EGF (16)
- SOX9 (15)
- HDAC1 (13)
- GLI2 (11)
- MAP2 (10)
- POU5F1 (10)
- BDNF (9)
- SOX2 (9)
- SMURF2 (8)
- GATA1 (7)
- IGFBP1 (7)
- LEF1 (7)
- BMP4 (6)
- SFRP1 (6)
- TAL1 (6)
- WNT3A (6)
- KLF4 (5)
- WNT1 (5)
- DKK1 (4)
- FGF4 (4)
- FGF7 (4)
- HNF1A (4)
- PAX3 (4)
- PAX7 (4)
- ADGRE5 (3)
- BMP15 (3)
- BMP2 (3)
- BMP7 (3)
- CD9 (3)
- GDF9 (3)
- GLI3 (3)
- SOX10 (3)
- WNT2 (3)
- WNT5A (3)
- WNT6 (3)
- BMP5 (2)
- BMP6 (2)
- GDF3 (2)
- LIF (2)
- NEUROD1 (2)
- BMP8B (1)
- CCN4 (1)
- DKK2 (1)
- DKK4 (1)
- FGF10 (1)
- GATA2 (1)
- GDF5 (1)
- IGFBP2 (1)
- PAX6 (1)
- PDGFC (1)
- SFRP4 (1)
- SFRP5 (1)
- WNT7B (1)
Reactivities
- Human (696)
- Mouse (325)
- Rat (278)
- Dog (22)
- Monkey (22)
- Bovine (8)
- Chicken (6)
- Pig (6)
- Cow (5)
- Primate (5)
- Rabbit (4)
- Bat (2)
- Feline (2)
- Hamster (2)
- Sheep (2)
- Xenopus (2)
- Canine (1)
- Canis (1)
- Chimpanzee (1)
- Gibbon (1)
- Goat (1)
- Gorilla (1)
- Guinea Pig (1)
- Horse (1)
- Macaque (1)
- Porcine (1)
- Quail (1)
- X. tropicalis (1)
- Zebrafish (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Hematopoietic cell lineage (295)
- Pathways in cancer (288)
- Endocytosis (170)
- Cytokine-cytokine receptor interaction (166)
- Cell adhesion molecules (CAMs) (162)
- MAPK signaling pathway (142)
- Regulation of actin cytoskeleton (134)
- Antigen processing and presentation (128)
- Melanoma (127)
- Primary immunodeficiency (120)
- T cell receptor signaling pathway (120)
- ErbB signaling pathway (101)
- Focal adhesion (99)
- Hedgehog signaling pathway (92)
- Basal cell carcinoma (91)
- Melanogenesis (89)
- Calcium signaling pathway (85)
- Prostate cancer (83)
- Dorso-ventral axis formation (82)
- Endometrial cancer (82)
- Gap junction (76)
- Bladder cancer (75)
- Glioma (75)
- Non-small cell lung cancer (75)
- Pancreatic cancer (75)
- Acute myeloid leukemia (68)
- Adherens junction (66)
- Colorectal cancer (66)
- Notch signaling pathway (61)
- Epithelial cell signaling in Helicobacter pylori infection (59)
- GnRH signaling pathway (59)
- ECM-receptor interaction (47)
- Wnt signaling pathway (42)
- Alzheimer's disease (39)
- Maturity onset diabetes of the young (32)
- Pathogenic Escherichia coli infection (30)
- Toll-like receptor signaling pathway (30)
- TGF-beta signaling pathway (26)
- Prion diseases (23)
- Renal cell carcinoma (23)
- Huntington's disease (22)
- Cell cycle (13)
- Chronic myeloid leukemia (13)
- Neurotrophin signaling pathway (9)
- Allograft rejection (8)
- Autoimmune thyroid disease (8)
- Graft-versus-host disease (8)
- Type I diabetes mellitus (8)
- Ubiquitin mediated proteolysis (8)
- Viral myocarditis (8)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- Thyroid cancer (7)
- Jak-STAT signaling pathway (2)