EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-ARRB1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ARRB1 |
Rabbit Polyclonal Anti-ERBB4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ERBB4 |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
Modifications | Phospho-specific |
Rabbit anti-AP2B1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AP2B1 |
Mouse Monoclonal TFRC (CD71) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ARRB1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARRB1 |
Rabbit Polyclonal Anti-PARD6A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARD6A |
MCSF Receptor (CSF1R) (531-580) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 531-580 of Human c-Fms |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal Anti-Ret (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CEWRQGDGKGITR, corresponding to amino acid residues 541-553 of human Ret. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-ARRB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit Polyclonal CXCR4 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit anti-FGFR2 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human FGFR2 |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
Modifications | Phospho-specific |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
Modifications | Phospho-specific |
Rabbit anti-RAB5A Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAB5A |
GRK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GRK1 |
Goat Polyclonal Anti-Rab11a Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mousse, Canine, Monkey |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab11a produced in E. coli. |
Goat Polyclonal Anti-Rab11 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Mousse, Canine, Monkey |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
USD 515.00
In Stock
Rabbit Monoclonal antibody against CD25
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal TGFBR2 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal FGFR4 Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4. |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
Phospho-SRC-Y418 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y418 of human SRC |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RAB22A Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Murine |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
GRK2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
SMURF1 (66-96) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | SMURF1 antibody was raised against kLH conjugated synthetic peptide selected from the N-terminal region of human SMURF1 (aa 66-96). |
Rabbit Polyclonal CCR5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit polyclonal CSFR (Ab-809) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal anti-HER3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HER3. |
Rabbit anti-TFRC Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TFRC |
CCR5 mouse monoclonal antibody, clone T21/8, Aff - Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Human |
SMURF1 (165-269) mouse monoclonal antibody, clone 1D7, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal Antibody against CSF1R
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MCSF Receptor (CSF1R) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 940-971 amino acids from the C-terminal region of human MCSF Receptor (CSF1R). |
Chicken Polyclonal LDL-R Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LDL-R antibody was raised against an 18 amino acid peptide near the center of human LDL-R. |
Rabbit Polyclonal IGF1 Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human IGF1R protein (between residues 700-800) [UniProt P08069] |
Mouse Monoclonal LDL Receptor Antibody (C7)
Applications | IHC |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |
Rabbit polyclonal Ret (Ab-905) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Ret around the phosphorylation site of tyrosine 905 (D-S-YP-V-K). |
Rabbit polyclonal anti-PDGFR a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDGFR a. |
ADRB3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%). |
Rabbit anti-CDC42 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDC42 |
Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
Goat Polyclonal Anti-Rab11b Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mousse, Canine, Monkey |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab11b produced in E. coli. |
Goat Polyclonal Anti-Rab11 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Mousse, Canine, Monkey |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |