Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Antibodies
View as table Download
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C1QA goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization. |
Properdin (CFP) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | The antigen has been isolated from pooled Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plasminogen (PLG) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Rabbit polyclonal Anti-Sema3f Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, HRP
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | HRP |
| Immunogen | The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Monkey |
| Conjugation | Biotin |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Monkey |
| Conjugation | FITC |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight antimicrobial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, HRP
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Monkey |
| Conjugation | HRP |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Complement C3 (C3) rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | C3b (C3c+C3d) has a molecular weight of 170,000. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, Purified
| Applications | ELISA, FC, IHC, IP, R, WB |
| Reactivities | Human |
Factor H (CFH) mouse monoclonal antibody, clone OX-24, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
EMA (MUC1) mouse monoclonal antibody, clone EMA-39, Purified
| Applications | IF, IHC, IP |
| Reactivities | Human |
USD 480.00
2 Weeks
CD130 (IL6ST) mouse monoclonal antibody, clone B-S12, Azide Free
| Applications | FC, FN, IP, WB |
| Reactivities | Human |
Lactoferrin (LTF) goat polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Human |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Properdin (CFP) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The antigen has been isolated from pooled Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Lactoferrin (LTF) goat polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Monkey |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C1QA rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, Biotin
| Applications | ELISA, FC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, FITC
| Applications | ELISA, FC, IP, R, WB |
| Reactivities | Human |
| Conjugation | FITC |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
USD 485.00
2 Weeks
alpha 1 Fetoprotein (AFP) mouse monoclonal antibody, clone AFP-Y2, Aff - Purified
| Applications | ELISA, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 485.00
2 Weeks
alpha 1 Fetoprotein (AFP) mouse monoclonal antibody, clone AFP-Y1, Aff - Purified
| Applications | ELISA, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Lactoferrin (LTF) mouse monoclonal antibody, clone NI 25, Ascites
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
Lactoferrin (LTF) mouse monoclonal antibody, clone NI 25, Biotin
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Lactoferrin (LTF) mouse monoclonal antibody, clone NI 25, FITC
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | FITC |
Lactoferrin (LTF) mouse monoclonal antibody, clone NI 25, HRP
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | HRP |
Lactoferrin (LTF) mouse monoclonal antibody, clone NI 25, Purified
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
Lactoferrin (LTF) mouse monoclonal antibody, clone NI 25, TRITC
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | TRITC |
Laminin alpha 4 (LAMA4) mouse monoclonal antibody, clone 3H2, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
CD163 mouse monoclonal antibody, clone GHI/61, Aff - Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IP
Families
- Secreted Protein
Filter by
Target Symbol
- LIPG (105)
- SERPINA1 (26)
- LTF (16)
- C2 (7)
- CD8A (7)
- EGFR (5)
- PLG (5)
- C1QA (3)
- CFI (3)
- IL6ST (3)
- LAMA4 (3)
- SERPING1 (3)
- AFP (2)
- ALB (2)
- CD163 (2)
- CFH (2)
- CFP (2)
- FCGR3A (2)
- GUCA2B (2)
- KNG1 (2)
- SERPINF2 (2)
- TF (2)
- APOA1 (1)
- BMP2 (1)
- CD40 (1)
- CFB (1)
- ELN (1)
- F11 (1)
- GCG (1)
- GDF15 (1)
- GNAS (1)
- GSN (1)
- HP (1)
- IL6 (1)
- INSL3 (1)
- MUC1 (1)
- NOV (1)
- ORM1 (1)
- PROS1 (1)
- SEMA3F (1)
- SERPINA6 (1)
- SERPINA7 (1)
- SPINK1 (1)
- TFRC (1)
- TGFB3 (1)
- TGFBR3 (1)
- TNFRSF1A (1)
- TTR (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Pathways
- Glycerolipid metabolism (105)
- Metabolic pathways (105)
- Complement and coagulation cascades (56)
- Cytokine-cytokine receptor interaction (13)
- Systemic lupus erythematosus (13)
- Pathways in cancer (11)
- Hematopoietic cell lineage (10)
- Cell adhesion molecules (CAMs) (8)
- Focal adhesion (8)
- Primary immunodeficiency (8)
- Antigen processing and presentation (7)
- Endocytosis (7)
- MAPK signaling pathway (7)
- T cell receptor signaling pathway (7)
- Calcium signaling pathway (6)
- Colorectal cancer (6)
- Gap junction (6)
- GnRH signaling pathway (6)
- Pancreatic cancer (6)
- Regulation of actin cytoskeleton (6)
- Adherens junction (5)
- Bladder cancer (5)
- Dorso-ventral axis formation (5)
- Endometrial cancer (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- ErbB signaling pathway (5)
- Glioma (5)
- Melanoma (5)
- Neuroactive ligand-receptor interaction (5)
- Non-small cell lung cancer (5)
- Prostate cancer (5)
- Jak-STAT signaling pathway (4)
- Prion diseases (4)
- ECM-receptor interaction (3)
- Fc gamma R-mediated phagocytosis (3)
- Small cell lung cancer (3)
- Dilated cardiomyopathy (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Melanogenesis (2)
- Natural killer cell mediated cytotoxicity (2)
- TGF-beta signaling pathway (2)
- Toll-like receptor signaling pathway (2)
- Acute myeloid leukemia (1)
- Adipocytokine signaling pathway (1)
- Allograft rejection (1)
- Alzheimer's disease (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Axon guidance (1)
- Basal cell carcinoma (1)
- Cell cycle (1)
- Chronic myeloid leukemia (1)
- Cytosolic DNA-sensing pathway (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Long-term depression (1)
- NOD-like receptor signaling pathway (1)
- PPAR signaling pathway (1)
- Renal cell carcinoma (1)
- Taste transduction (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)