Germany
Japan
United Kingdom
China
Antibodies
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
USD 399.00
In Stock
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Active filters
Applications
- WB
Families
- Transmembrane
Filter by
Target Symbol
- KLK8 (243)
- CD4 (202)
- EGFR (156)
- PDCD1 (156)
- ERBB2 (153)
- ABCB1 (124)
- PECAM1 (122)
- HAVCR2 (121)
- MSMB (120)
- CD68 (118)
- CD5 (114)
- CD274 (111)
- CD99 (107)
- APP (94)
- EPCAM (94)
- L1CAM (94)
- MLANA (93)
- CD80 (88)
- BCL2 (86)
- KIT (74)
- PROCR (74)
- CD27 (73)
- CD44 (72)
- SPG7 (72)
- CD33 (69)
- NCAM1 (68)
- PDCD1LG2 (68)
- BSG (66)
- TNFRSF8 (66)
- BTLA (65)
- CD19 (65)
- PTPRC (65)
- FCGR2A (63)
- LGR5 (63)
- SYP (63)
- CD63 (61)
- RET (61)
- CD40 (60)
- MET (60)
- MCL1 (59)
- CDH1 (58)
- FGG (58)
- NPR3 (58)
- CD163 (57)
- CD86 (57)
- PDGFRA (57)
- MSR1 (55)
- PTPRE (55)
- MS4A1 (54)
- CD1C (53)
- CYP1A2 (51)
- ERBB3 (51)
- FBXW7 (51)
- PCDH7 (51)
- RPN1 (51)
- BTN1A1 (50)
- CD22 (50)
- FGFR2 (50)
- PDIA4 (50)
- SLC2A5 (50)
- APMAP (48)
- HP (48)
- MTDH (48)
- MUC1 (48)
- LRRC25 (47)
- POR (47)
- WNT3 (47)
- LAG3 (46)
- TAPBPL (46)
- UBE2J1 (46)
- VCAM1 (46)
- FATE1 (45)
- GOLM1 (45)
- MSLN (45)
- CD34 (44)
- ENPEP (44)
- GPNMB (44)
- HMOX2 (44)
- ACE2 (43)
- FOLH1 (43)
- CD2 (42)
- CD79B (42)
- CDH2 (42)
- KCNJ3 (42)
- KDR (42)
- TMEFF2 (42)
- ICAM3 (41)
- NEU1 (41)
- PDGFRB (41)
- POMK (41)
- SYT4 (41)
- FXYD3 (40)
- TPSG1 (40)
- CDCP1 (39)
- CYP2J2 (39)
- FCER2 (39)
- BNIP1 (38)
- FGFR1 (38)
- TNF (38)
- VIP (38)
Reactivities
- Human (18154)
- Mouse (6919)
- Rat (6207)
- Dog (613)
- Monkey (512)
- Cow (129)
- Bovine (120)
- Pig (102)
- Canine (51)
- Primate (42)
- Rabbit (41)
- Chicken (37)
- Rhesus Monkey (28)
- Hamster (25)
- Xenopus (21)
- Porcine (20)
- Sheep (19)
- Chimpanzee (16)
- Zebrafish (15)
- Guinea Pig (11)
- X. tropicalis (9)
- Drosophila (7)
- Macaque (7)
- Equine (5)
- Feline (5)
- Goat (3)
- Quail (3)
- Avian (2)
- Fish (2)
- Opossum (2)
- Canis (1)
- Eukaryote (1)
- Mink (1)
- Murine (1)
- Mustelid (1)
- Squirrel (1)
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Cell adhesion molecules (CAMs) (2157)
- Cytokine-cytokine receptor interaction (1937)
- Hematopoietic cell lineage (1461)
- Pathways in cancer (1406)
- Metabolic pathways (1098)
- Neuroactive ligand-receptor interaction (913)
- Endocytosis (854)
- Calcium signaling pathway (835)
- Focal adhesion (814)
- Prostate cancer (637)
- MAPK signaling pathway (596)
- Adherens junction (588)
- Regulation of actin cytoskeleton (586)
- T cell receptor signaling pathway (573)
- Colorectal cancer (537)
- Leukocyte transendothelial migration (523)
- Melanoma (499)
- ErbB signaling pathway (462)
- Primary immunodeficiency (460)
- Systemic lupus erythematosus (445)
- Bladder cancer (423)
- Jak-STAT signaling pathway (418)
- Olfactory transduction (416)
- Toll-like receptor signaling pathway (416)
- Pancreatic cancer (398)
- Endometrial cancer (391)
- Alzheimer's disease (380)
- Viral myocarditis (372)
- Apoptosis (371)
- Antigen processing and presentation (369)
- Axon guidance (357)
- Allograft rejection (356)
- Gap junction (353)
- Lysosome (345)
- Autoimmune thyroid disease (343)
- Non-small cell lung cancer (336)
- Epithelial cell signaling in Helicobacter pylori infection (333)
- Natural killer cell mediated cytotoxicity (309)
- Glioma (306)
- Graft-versus-host disease (299)
- Type I diabetes mellitus (295)
- Melanogenesis (267)
- ABC transporters (264)
- Amyotrophic lateral sclerosis (ALS) (252)
- ECM-receptor interaction (227)
- Neurotrophin signaling pathway (227)
- GnRH signaling pathway (219)
- Dilated cardiomyopathy (209)
- Hypertrophic cardiomyopathy (HCM) (202)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (201)
- Fc gamma R-mediated phagocytosis (200)
- Drug metabolism - cytochrome P450 (199)
- Parkinson's disease (189)
- B cell receptor signaling pathway (187)
- SNARE interactions in vesicular transport (182)
- Basal cell carcinoma (181)
- Huntington's disease (175)
- Retinol metabolism (173)
- Renin-angiotensin system (171)
- Adipocytokine signaling pathway (165)
- Dorso-ventral axis formation (164)
- Asthma (163)
- Chemokine signaling pathway (163)
- Small cell lung cancer (153)
- Hedgehog signaling pathway (150)
- Tight junction (146)
- Linoleic acid metabolism (142)
- N-Glycan biosynthesis (138)
- Metabolism of xenobiotics by cytochrome P450 (136)
- TGF-beta signaling pathway (132)
- Pathogenic Escherichia coli infection (130)
- Wnt signaling pathway (130)
- Oxidative phosphorylation (129)
- Thyroid cancer (129)
- Complement and coagulation cascades (125)
- Prion diseases (125)
- Vascular smooth muscle contraction (113)
- Sphingolipid metabolism (112)
- PPAR signaling pathway (110)
- Arachidonic acid metabolism (109)
- RIG-I-like receptor signaling pathway (107)
- Ubiquitin mediated proteolysis (105)
- Tryptophan metabolism (104)
- Renal cell carcinoma (102)
- Vibrio cholerae infection (99)
- Fatty acid metabolism (98)
- Caffeine metabolism (97)
- Cardiac muscle contraction (96)
- Acute myeloid leukemia (94)
- Drug metabolism - other enzymes (90)
- Porphyrin and chlorophyll metabolism (84)
- Purine metabolism (83)
- p53 signaling pathway (78)
- Glycerolipid metabolism (77)
- NOD-like receptor signaling pathway (77)
- Notch signaling pathway (74)
- Long-term depression (73)
- Fc epsilon RI signaling pathway (69)
- Long-term potentiation (67)
- Chronic myeloid leukemia (62)
- Glycerophospholipid metabolism (62)
- Androgen and estrogen metabolism (61)
- Pyrimidine metabolism (60)
- Type II diabetes mellitus (60)
- Ascorbate and aldarate metabolism (57)
- Insulin signaling pathway (57)
- Cytosolic DNA-sensing pathway (53)
- Glycosphingolipid biosynthesis - lacto and neolacto series (53)
- Keratan sulfate biosynthesis (51)
- Nitrogen metabolism (51)
- VEGF signaling pathway (51)
- Progesterone-mediated oocyte maturation (50)
- Nicotinate and nicotinamide metabolism (47)
- O-Glycan biosynthesis (47)
- Taste transduction (47)
- Tyrosine metabolism (47)
- Glycolysis / Gluconeogenesis (44)
- Other glycan degradation (42)
- Propanoate metabolism (42)
- Valine (42)
- leucine and isoleucine degradation (42)
- Ether lipid metabolism (41)
- Oocyte meiosis (41)
- beta-Alanine metabolism (41)
- Arginine and proline metabolism (40)
- Glutathione metabolism (40)
- Histidine metabolism (40)
- Starch and sucrose metabolism (40)
- Lysine degradation (38)
- Limonene and pinene degradation (37)
- Butanoate metabolism (36)
- Pyruvate metabolism (36)
- Biosynthesis of unsaturated fatty acids (33)
- Riboflavin metabolism (33)
- Heparan sulfate biosynthesis (30)
- Primary bile acid biosynthesis (30)
- Chondroitin sulfate biosynthesis (28)
- Amino sugar and nucleotide sugar metabolism (27)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (25)
- Pentose and glucuronate interconversions (25)
- Glycosphingolipid biosynthesis - ganglio series (18)
- Galactose metabolism (15)
- Glycosphingolipid biosynthesis - globo series (15)
- Steroid biosynthesis (14)
- Glycosaminoglycan degradation (13)
- Glycine (11)
- Protein export (11)
- alpha-Linolenic acid metabolism (11)
- serine and threonine metabolism (11)
- C21-Steroid hormone metabolism (10)
- Cell cycle (10)
- Phenylalanine metabolism (10)
- Cyanoamino acid metabolism (8)
- Phosphatidylinositol signaling system (8)
- Selenoamino acid metabolism (8)
- Taurine and hypotaurine metabolism (8)
- Inositol phosphate metabolism (7)
- Base excision repair (5)
- O-Mannosyl glycan biosynthesis (5)
- Sulfur metabolism (5)
- Maturity onset diabetes of the young (2)
- Terpenoid backbone biosynthesis (2)
- Citrate cycle (TCA cycle) (1)
- Pantothenate and CoA biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)