Antibodies

View as table Download

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey

BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey

Bax Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Bax

Rabbit Polyclonal p53R2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

Rabbit Polyclonal KAI1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KAI1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human KAI1.
BAX

USD 320.00

In Stock

Goat Polyclonal Anti-BAX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli.

DR5 (TNFRSF10B) (380-398) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human TNFRSF10B / DR5, aa 380-398

Rabbit Polyclonal DR5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DR5 antibody was raised against a peptide corresponding to 20 amino acids near the carboxy terminus of human DR5 precursor. The immunogen is located within the last 50 amino acids of DR5.

Rabbit polyclonal anti-BAX antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.

Rabbit polyclonal anti-BAI1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAI1.

Rabbit polyclonal anti-Bax antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Bax.

Rabbit polyclonal anti-STEA3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STEA3.

STEAP3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human STEAP3

Rabbit anti-TNFRSF10B Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFRSF10B

Rabbit Polyclonal Anti-Bax Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax

Rabbit Polyclonal Anti-STEA3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-STEA3 Antibody: A synthesized peptide derived from human STEA3

DR5 (TNFRSF10B) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Canine, Human
Conjugation Biotin
Immunogen Highly pure (>98%) 14,9 kDa recombinant Human soluble TRAIL Receptor-2.

Rabbit Polyclonal STEAP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STEAP3 antibody was raised against a 15 amino acid peptide from near the amino terminus of human STEAP3.

BAX rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

DR5 (TNFRSF10B) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) 14,9 kDa recombinant Human soluble TRAIL Receptor-2.

DR5 (TNFRSF10B) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2.

DR5 (TNFRSF10B) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2.

Rabbit Polyclonal PERP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PERP antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human PERP, which differ from the mouse sequence by three amino acids (7-9) .

Rabbit Polyclonal Bax Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bax antibody was raised against a peptide corresponding to 16 amino acids near the amino-terminus of human Bax.

Rabbit polyclonal Bax (Ab-167) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T)

Rabbit polyclonal anti-RRM2B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RRM2B.

Rabbit polyclonal RRM2B p53R2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Human RRM2B/p53R2 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human RRM2B1 protein. A residue of cysteine was added to facilitate coupling.

Rabbit Polyclonal EI24 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EI24 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human EI24.

Rabbit Polyclonal Bax Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Bax.

BAX (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping near the N-terminal of human BAX

CD82 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human CD82

STEAP3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 440-470 amino acids from the C-terminal region of human STEAP3

Goat Polyclonal Antibody against PERP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CLPNYEDDLLGNAK, from the C Terminus of the protein sequence according to NP_071404.2.

Mouse Monoclonal anti-Bax Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-STEAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the C terminal of human STEAP3. Synthetic peptide located within the following region: VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Rabbit Polyclonal Anti-STEAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the N terminal of human STEAP3. Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY

Rabbit anti-CD82 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD82

Rabbit anti-EI24 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EI24

Rabbit Polyclonal TRAIL R2/TNFRSF10B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Rabbit anti-DR5 polyclonal antibody was raised against a peptide corresponding to amino acids 388 to 407 (isoform 2) of human DR5 precursor (1,2). The same sequence is found in isoform 1 at amino acids 417-436.

Rabbit Polyclonal Anti-PERP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PERP antibody: synthetic peptide directed towards the middle region of human PERP. Synthetic peptide located within the following region: FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG

Rabbit Polyclonal Anti-SCOTIN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCOTIN antibody: synthetic peptide directed towards the middle region of human SCOTIN. Synthetic peptide located within the following region: CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV

Rabbit Polyclonal Anti-CD82 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD82 antibody is: synthetic peptide directed towards the middle region of CD82. Synthetic peptide located within the following region: ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY

Mouse Monoclonal Bax Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated

Mouse Monoclonal Bax Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated

Mouse Monoclonal DR5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF10B mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF10B mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF10B mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated