Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-VTN Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN. Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE |
USD 340.00
2 Weeks
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal Filamin A (Ser2152) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Filamin A around the phosphorylation site of serine 2152 (A-P-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Active filters
Applications
- WB
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (222)
- JUN (173)
- EGFR (156)
- ERBB2 (153)
- CTNNB1 (149)
- AKT1 (116)
- BRAF (92)
- VWF (91)
- BCL2 (86)
- MAPK1 (68)
- PIK3CG (63)
- PARVA (61)
- MET (60)
- PDGFRA (57)
- MAPK8 (54)
- PXN (48)
- VEGFA (48)
- PIK3R5 (46)
- HRAS (45)
- BIRC3 (43)
- VASP (43)
- KDR (42)
- CCND2 (41)
- PDGFRB (41)
- AKT2 (39)
- ACTB (38)
- SPP1 (37)
- CCND1 (35)
- PTK2 (35)
- LAMB3 (32)
- PARVB (32)
- SHC1 (32)
- MAPK9 (31)
- PIK3CD (29)
- RAF1 (29)
- SRC (29)
- BCAR1 (28)
- IGF1 (27)
- MYL7 (26)
- PRKCA (26)
- IGF1R (25)
- EGF (24)
- FLT4 (24)
- HGF (24)
- RAPGEF1 (24)
- VEGFB (24)
- VEGFD (24)
- MAPK3 (22)
- PAK4 (22)
- FN1 (21)
- CAV1 (20)
- MAPK10 (19)
- FLT1 (18)
- PAK1 (18)
- AKT3 (17)
- BAD (17)
- GSK3B (17)
- ITGB1 (17)
- LAMA4 (17)
- ACTN1 (15)
- PTEN (15)
- ITGB3 (14)
- ROCK2 (14)
- COL6A1 (13)
- VCL (13)
- CAPN2 (12)
- PPP1CA (12)
- PRKCB (12)
- FYN (11)
- PDGFB (11)
- PIK3R1 (11)
- COL5A1 (10)
- GRB2 (10)
- ILK (10)
- VEGFC (10)
- COL3A1 (9)
- ELK1 (9)
- MYL9 (9)
- RHOA (9)
- VAV1 (9)
- ACTN2 (8)
- COL1A1 (8)
- FLNA (8)
- ITGA4 (8)
- ACTG1 (7)
- CAV2 (7)
- CCND3 (7)
- ITGAV (7)
- ITGB4 (7)
- LAMB2 (7)
- PAK2 (7)
- PDGFA (7)
- PDPK1 (7)
- PGF (7)
- PPP1CC (7)
- XIAP (7)
- ZYX (7)
- ACTN4 (6)
- BIRC2 (6)
- COL1A2 (6)
Reactivities
- Human (3124)
- Mouse (2643)
- Rat (2538)
- Dog (528)
- Monkey (511)
- Bovine (36)
- Chicken (34)
- Pig (19)
- Rabbit (18)
- Cow (13)
- Xenopus (12)
- Canine (11)
- Canis (8)
- Drosophila (8)
- Hamster (8)
- Rhesus Monkey (8)
- Primate (5)
- Sheep (5)
- X. tropicalis (5)
- Zebrafish (4)
- Guinea Pig (3)
- Porcine (3)
- C. elegans (2)
- Chimpanzee (2)
- All Species (1)
- Avian (1)
- Broad (1)
- Feline (1)
- Goat (1)
- Horse (1)
- Tobacco hornworm (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (3297)
- Protein Kinase (1523)
- ES Cell Differentiation/IPS (1317)
- Transmembrane (814)
- Secreted Protein (552)
- Transcription Factors (345)
- Stem cell - Pluripotency (239)
- Stem cell relevant signaling - JAK/STAT signaling pathway (220)
- Adult stem cells (208)
- Cancer stem cells (156)
- Phosphatase (40)
- Protease (36)
- Stem cell relevant signaling - DSL/Notch pathway (35)
- Stem cell relevant signaling - Wnt Signaling pathway (35)
- Embryonic stem cells (28)
- Induced pluripotent stem cells (28)